Recombinant Human TCEB1 protein, GST-tagged
| Cat.No. : | TCEB1-3153H |
| Product Overview : | Recombinant Human TCEB1 protein(1-112 aa), fused with N-terminal GST tag, was expressed in E. coli. |
| Availability | July 29, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E. coli |
| Tag : | GST |
| Protein Length : | 1-112 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
| AASequence : | MDGEEKTYGGCEGPDAMYVKLISSDGHEFIVKREHALTSGTIKAMLSGPGQFAENETNEVNFREIPSHVLSKVCMYFTYKVRYTNSSTEIPEFPIAPEIALELLMAANFLDC |
| Purity : | 85%, by SDS-PAGE. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| Gene Name | TCEB1 transcription elongation factor B (SIII), polypeptide 1 (15kDa, elongin C) [ Homo sapiens ] |
| Official Symbol | TCEB1 |
| Synonyms | TCEB1; transcription elongation factor B (SIII), polypeptide 1 (15kDa, elongin C); transcription elongation factor B (SIII), polypeptide 1 (15kD, elongin C); transcription elongation factor B polypeptide 1; SIII; SIII p15; elongin-C; elongin 15 kDa subunit; transcription elongation factor B, polypeptide 1; RNA polymerase II transcription factor SIII subunit C; eloC; |
| mRNA Refseq | NM_001204857 |
| Protein Refseq | NP_001191786 |
| MIM | 600788 |
| UniProt ID | Q15369 |
| Gene ID | 6921 |
| ◆ Recombinant Proteins | ||
| TCEB1-30815TH | Recombinant Human TCEB1 | +Inquiry |
| TCEB1-5986R | Recombinant Rat TCEB1 Protein | +Inquiry |
| TCEB1-8786H | Recombinant Human TCEB1 protein, His-tagged | +Inquiry |
| TCEB1-5645R | Recombinant Rat TCEB1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| TCEB1-9074M | Recombinant Mouse TCEB1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TCEB1-1189HCL | Recombinant Human TCEB1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TCEB1 Products
Required fields are marked with *
My Review for All TCEB1 Products
Required fields are marked with *



