Recombinant Human TCF4 protein, GST-tagged
Cat.No. : | TCF4-29463TH |
Product Overview : | Recombinant Human TCF4 full-length ORF ( AAH31056.1, 1 a.a. - 365 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 65.89kDa |
AA Sequence : | MHHQQRMAALGTDKELSDLLDFSAMFSPPVSSGKNGPTSLASGHFTGSNVEDRSSSGSWGNGGHPSPSRNYGDGT PYDHTTSRDLGSHDNLSPPFVNSRIQSKTERGSYSSYGRESNLQGCHQQSLLGGDMDMGNPGTLSPTKPGSQYYQ YSSNNPRRRPLHSSAMEVQTKKVRKVPPGLPSSVYAPSASTADYNRDSPGYPSSKPATSTFPSSFFMQDGHHSSD PWSSSSGMNQPGYAGMLGNSSHIPQSSSYCSLHPHERLSYPSHSSADINSSLPPMSTFHRSGTNHYSTSSCTPPA NGTDSIMANRGSGAAGSSQTGDALGKALASIYSPDHTNNSFSSNPSTPVGSPPSLSAGTAVWSRN |
Applications : | ELISA; WB; Antibody Production; Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | TCF4 transcription factor 4 [ Homo sapiens ] |
Official Symbol | TCF4 |
Synonyms | TCF4; transcription factor 4; bHLHb19; E2 2; ITF2; SEF2 1B; SL3-3 enhancer factor 2; transcription factor 4, isoform D; transcription factor 4, isoform R; immunoglobulin transcription factor 2; class B basic helix-loop-helix protein 19; E2-2; PTHS; SEF2; ITF-2; SEF-2; TCF-4; SEF2-1; SEF2-1A; SEF2-1B; MGC149723; MGC149724; |
Gene ID | 6925 |
mRNA Refseq | NM_001083962 |
Protein Refseq | NP_001077431 |
MIM | 602272 |
UniProt ID | P15884 |
Chromosome Location | 18q21.1 |
Pathway | CDO in myogenesis, organism-specific biosystem; Coregulation of Androgen receptor activity, organism-specific biosystem; Developmental Biology, organism-specific biosystem; Myogenesis, organism-specific biosystem; Regulation of Wnt-mediated beta catenin signaling and target gene transcription, organism-specific biosystem; Wnt Signaling Pathway NetPath, organism-specific biosystem; |
Function | DNA binding; E-box binding; RNA polymerase II core promoter proximal region sequence-specific DNA binding; RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in positive regulation of transcription; TFIIB-class binding transcription factor activity; TFIIB-class transcription factor binding; protein C-terminus binding; protein binding; protein heterodimerization activity; protein heterodimerization activity; sequence-specific DNA binding RNA polymerase recruiting transcription factor activity; sequence-specific DNA binding transcription factor activity; |
◆ Recombinant Proteins | ||
TCF4-5649R | Recombinant Rat TCF4 Protein, His (Fc)-Avi-tagged | +Inquiry |
TCF4-9081M | Recombinant Mouse TCF4 Protein, His (Fc)-Avi-tagged | +Inquiry |
Tcf4-6340M | Recombinant Mouse Tcf4 Protein, Myc/DDK-tagged | +Inquiry |
TCF4-31H | Recombinant Human TCF4 protein, His-tagged | +Inquiry |
TCF4-742HFL | Recombinant Full Length Human TCF4 Protein, C-Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TCF4-1179HCL | Recombinant Human TCF4 293 Cell Lysate | +Inquiry |
TCF4-1178HCL | Recombinant Human TCF4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TCF4 Products
Required fields are marked with *
My Review for All TCF4 Products
Required fields are marked with *
0
Inquiry Basket