Recombinant Full Length Human TEX19 Protein, GST-tagged

• Cat.No.: TEX19-5039HF
• Product Overview: Human FLJ35767 full-length ORF ( NP_997342.1, 1 a.a. - 164 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 164 amino acids
• Description: TEX19 (Testis Expressed 19) is a Protein Coding gene.
• Molecular Mass: 44.9 kDa
• AA Sequence: MCPPVSMRYEEEGMSYLYASWMYQLQHGDQLSICFTCFKAAFLDFKDLLESEDWEEDNWDPELMEHTEAESEQEGSSGMELSWGQSPGQPVQGGSEAWGPGTLAAAPEGLEDAGLDPHFVPTELWPQEAVPLGLGLEDADWTQGLPWRFEELLTCSHWPSFFPS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: TEX19 testis expressed 19 [ Homo sapiens (human) ]
• Official Symbol: TEX19
• Synonyms: TEX19; testis expressed 19; testis-expressed protein 19; testis-expressed sequence 19 protein
• Gene ID: 400629
• mRNA Refseq: NM_207459
• Protein Refseq: NP_997342
• MIM: 615647
• UniProt ID: Q8NA77