Recombinant Human TEX19 Protein, GST-tagged
Cat.No. : | TEX19-4317H |
Product Overview : | Human FLJ35767 full-length ORF ( NP_997342.1, 1 a.a. - 164 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | TEX19 (Testis Expressed 19) is a Protein Coding gene. |
Molecular Mass : | 44.9 kDa |
AA Sequence : | MCPPVSMRYEEEGMSYLYASWMYQLQHGDQLSICFTCFKAAFLDFKDLLESEDWEEDNWDPELMEHTEAESEQEGSSGMELSWGQSPGQPVQGGSEAWGPGTLAAAPEGLEDAGLDPHFVPTELWPQEAVPLGLGLEDADWTQGLPWRFEELLTCSHWPSFFPS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | TEX19 testis expressed 19 [ Homo sapiens (human) ] |
Official Symbol | TEX19 |
Synonyms | TEX19; testis expressed 19; testis-expressed protein 19; testis-expressed sequence 19 protein |
Gene ID | 400629 |
mRNA Refseq | NM_207459 |
Protein Refseq | NP_997342 |
UniProt ID | Q8NA77 |
◆ Recombinant Proteins | ||
TEX19-5039HF | Recombinant Full Length Human TEX19 Protein, GST-tagged | +Inquiry |
TEX19-4487R | Recombinant Rhesus Macaque TEX19 Protein, His (Fc)-Avi-tagged | +Inquiry |
TEX19-4317H | Recombinant Human TEX19 Protein, GST-tagged | +Inquiry |
TEX19-4671R | Recombinant Rhesus monkey TEX19 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TEX19-281HCL | Recombinant Human TEX19 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TEX19 Products
Required fields are marked with *
My Review for All TEX19 Products
Required fields are marked with *
0
Inquiry Basket