Recombinant Full Length Human TEX29 Protein, GST-tagged

• Cat.No.: TEX29-1773HF
• Product Overview: Human C13orf16 full-length ORF (AAH29889.1, 1 a.a. - 151 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 151 amino acids
• Description: Predicted to be integral component of membrane.
• Form: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 43.01 kDa
• AA Sequence: MEYVLEVKNSPRHLLKQFTVCDVPLYDICDYNVSRDRCQELGCCFYEGVCYKKAVPIYIHVFSALIVIIAGAFVITIIYRVIQESRKEKAIPVDVALPQKSSEKAELASSSSKLGLKPASPGPPSAGPSMKSDEDKDDVTGTITEAEETED
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: TEX29 testis expressed 29 [ Homo sapiens (human) ]
• Official Symbol: TEX29
• Synonyms: C13orf16; bA474D23.1
• Gene ID: 121793
• mRNA Refseq: NM_001303133.1
• Protein Refseq: NP_001290062.1
• UniProt ID: Q8N6K0