Recombinant Full Length Human TEX29 Protein, GST-tagged
Cat.No. : | TEX29-1773HF |
Product Overview : | Human C13orf16 full-length ORF (AAH29889.1, 1 a.a. - 151 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 151 amino acids |
Description : | Predicted to be integral component of membrane. |
Form : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 43.01 kDa |
AA Sequence : | MEYVLEVKNSPRHLLKQFTVCDVPLYDICDYNVSRDRCQELGCCFYEGVCYKKAVPIYIHVFSALIVIIAGAFVITIIYRVIQESRKEKAIPVDVALPQKSSEKAELASSSSKLGLKPASPGPPSAGPSMKSDEDKDDVTGTITEAEETED |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | TEX29 testis expressed 29 [ Homo sapiens (human) ] |
Official Symbol | TEX29 |
Synonyms | C13orf16; bA474D23.1 |
Gene ID | 121793 |
mRNA Refseq | NM_001303133.1 |
Protein Refseq | NP_001290062.1 |
UniProt ID | Q8N6K0 |
◆ Recombinant Proteins | ||
TEX29-6022R | Recombinant Rat TEX29 Protein | +Inquiry |
TEX29-1773HF | Recombinant Full Length Human TEX29 Protein, GST-tagged | +Inquiry |
TEX29-522H | Recombinant Human TEX29 Protein, GST-tagged | +Inquiry |
Tex29-6368M | Recombinant Mouse Tex29 Protein, Myc/DDK-tagged | +Inquiry |
TEX29-5681R | Recombinant Rat TEX29 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TEX29-8304HCL | Recombinant Human C13orf16 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TEX29 Products
Required fields are marked with *
My Review for All TEX29 Products
Required fields are marked with *