Recombinant Human TEX29 Protein, GST-tagged

Cat.No. : TEX29-522H
Product Overview : Human C13orf16 full-length ORF (AAH29889.1, 1 a.a. - 151 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 43.01 kDa
AA Sequence : MEYVLEVKNSPRHLLKQFTVCDVPLYDICDYNVSRDRCQELGCCFYEGVCYKKAVPIYIHVFSALIVIIAGAFVITIIYRVIQESRKEKAIPVDVALPQKSSEKAELASSSSKLGLKPASPGPPSAGPSMKSDEDKDDVTGTITEAEETED
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name TEX29 testis expressed 29 [ Homo sapiens (human) ]
Official Symbol TEX29
Synonyms C13orf16; bA474D23.1
Gene ID 121793
mRNA Refseq NM_001303133.1
Protein Refseq NP_001290062.1
UniProt ID Q8N6K0.1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TEX29 Products

Required fields are marked with *

My Review for All TEX29 Products

Required fields are marked with *

0
cart-icon
0
compare icon