Recombinant Full Length Human Thioredoxin-Related Transmembrane Protein 4(Tmx4) Protein, His-Tagged
Cat.No. : | RFL36311HF |
Product Overview : | Recombinant Full Length Human Thioredoxin-related transmembrane protein 4(TMX4) Protein (Q9H1E5) (24-349aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (24-349) |
Form : | Lyophilized powder |
AA Sequence : | TAGPEEAALPPEQSRVQPMTASNWTLVMEGEWMLKFYAPWCPSCQQTDSEWEAFAKNGEI LQISVGKVDVIQEPGLSGRFFVTTLPAFFHAKDGIFRRYRGPGIFEDLQNYILEKKWQSV EPLTGWKSPASLTMSGMAGLFSISGKIWHLHNYFTVTLGIPAWCSYVFFVIATLVFGLFM GLVLVVISECFYVPLPRHLSERSEQNRRSEEAHRAEQLQDAEEEKDDSNEEENKDSLVDD EEEKEDLGDEDEAEEEEEEDNLAAGVDEERSEANDQGPPGEDGVTREEVEPEEAEEGISE QPCPADTEVVEDSLRQRKSQHADKGL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | TMX4 |
Synonyms | TMX4; KIAA1162; TXNDC13; PSEC0095; UNQ475/PRO938; Thioredoxin-related transmembrane protein 4; Thioredoxin domain-containing protein 13 |
UniProt ID | Q9H1E5 |
◆ Recombinant Proteins | ||
TMX4-13HFL | Recombinant Full Length Human TMX4 Protein, C-Myc/DDK-tagged | +Inquiry |
Tmx4-6537M | Recombinant Mouse Tmx4 Protein, Myc/DDK-tagged | +Inquiry |
TMX4-4282C | Recombinant Chicken TMX4 | +Inquiry |
TMX4-4859R | Recombinant Rhesus monkey TMX4 Protein, His-tagged | +Inquiry |
RFL21154MF | Recombinant Full Length Mouse Thioredoxin-Related Transmembrane Protein 4(Tmx4) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TMX4-898HCL | Recombinant Human TMX4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TMX4 Products
Required fields are marked with *
My Review for All TMX4 Products
Required fields are marked with *
0
Inquiry Basket