Recombinant Full Length Human TIPRL Protein, C-Flag-tagged

• Cat.No.: TIPRL-1573HFL
• Product Overview: Recombinant Full Length Human TIPRL Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.

Specification

• Species: Human
• Source: Mammalian Cells
• Tag: Flag
• Description: TIPRL is an inhibitory regulator of protein phosphatase-2A (PP2A), PP4, and PP6.
• Form: 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
• Molecular Mass: 31.3 kDa
• AA Sequence: MMIHGFQSSHRDFCFGPWKLTASKTHIMKSADVEKLADELHMPSLPEMMFGDNVLRIQHGSGFGIEFNAT DALRCVNNYQGMLKVACAEEWQESRTEGEHSKEVIKPYDWTYTTDYKGTLLGESLKLKVVPTTDHIDTEK LKAREQIKFFEEVLLFEDELHDHGVSSLSVKIRVMPSSFFLLLRFFLRIDGVLIRMNDTRLYHEADKTYM
  LREYTSRESKISSLMHVPPSLFTEPNEISQYLPIKEAVCEKLIFPERIDPNPADSQKSTQVETRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Storage: Store at -80 centigrade.
• Concentration: >50 ug/mL as determined by microplate BCA method.
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Full Length: Full L.

Gene Information

• Gene Name: TIPRL TOR signaling pathway regulator [ Homo sapiens (human) ]
• Official Symbol: TIPRL
• Synonyms: TIP; TIP41; TIPRL1
• Gene ID: 261726
• mRNA Refseq: NM_152902.5
• Protein Refseq: NP_690866.1
• MIM: 611807
• UniProt ID: O75663