Recombinant Full Length Human TIPRL Protein, C-Flag-tagged
Cat.No. : | TIPRL-1573HFL |
Product Overview : | Recombinant Full Length Human TIPRL Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | TIPRL is an inhibitory regulator of protein phosphatase-2A (PP2A), PP4, and PP6. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 31.3 kDa |
AA Sequence : | MMIHGFQSSHRDFCFGPWKLTASKTHIMKSADVEKLADELHMPSLPEMMFGDNVLRIQHGSGFGIEFNAT DALRCVNNYQGMLKVACAEEWQESRTEGEHSKEVIKPYDWTYTTDYKGTLLGESLKLKVVPTTDHIDTEK LKAREQIKFFEEVLLFEDELHDHGVSSLSVKIRVMPSSFFLLLRFFLRIDGVLIRMNDTRLYHEADKTYM LREYTSRESKISSLMHVPPSLFTEPNEISQYLPIKEAVCEKLIFPERIDPNPADSQKSTQVETRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | TIPRL TOR signaling pathway regulator [ Homo sapiens (human) ] |
Official Symbol | TIPRL |
Synonyms | TIP; TIP41; TIPRL1 |
Gene ID | 261726 |
mRNA Refseq | NM_152902.5 |
Protein Refseq | NP_690866.1 |
MIM | 611807 |
UniProt ID | O75663 |
◆ Recombinant Proteins | ||
TIPRL-1573HFL | Recombinant Full Length Human TIPRL Protein, C-Flag-tagged | +Inquiry |
TIPRL-10932Z | Recombinant Zebrafish TIPRL | +Inquiry |
Tiprl-6439M | Recombinant Mouse Tiprl Protein, Myc/DDK-tagged | +Inquiry |
TIPRL-2196H | Recombinant Human TIPRL Protein, His (Fc)-Avi-tagged | +Inquiry |
TIPRL-3244H | Recombinant Human TIPRL, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TIPRL-1058HCL | Recombinant Human TIPRL 293 Cell Lysate | +Inquiry |
TIPRL-1057HCL | Recombinant Human TIPRL 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TIPRL Products
Required fields are marked with *
My Review for All TIPRL Products
Required fields are marked with *
0
Inquiry Basket