Recombinant Full Length Human TLR2 Protein, C-Flag-tagged
Cat.No. : | TLR2-1095HFL |
Product Overview : | Recombinant Full Length Human TLR2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene is a member of the Toll-like receptor (TLR) family which plays a fundamental role in pathogen recognition and activation of innate immunity. TLRs are highly conserved from Drosophila to humans and share structural and functional similarities. This protein is a cell-surface protein that can form heterodimers with other TLR family members to recognize conserved molecules derived from microorganisms known as pathogen-associated molecular patterns (PAMPs). Activation of TLRs by PAMPs leads to an up-regulation of signaling pathways to modulate the host's inflammatory response. This gene is also thought to promote apoptosis in response to bacterial lipoproteins. This gene has been implicated in the pathogenesis of several autoimmune diseases. Alternative splicing results in multiple transcript variants. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 89.7 kDa |
AA Sequence : | MPHTLWMVWVLGVIISLSKEESSNQASLSCDRNGICKGSSGSLNSIPSGLTEAVKSLDLSNNRITYISNS DLQRCVNLQALVLTSNGINTIEEDSFSSLGSLEHLDLSYNYLSNLSSSWFKPLSSLTFLNLLGNPYKTLG ETSLFSHLTKLQILRVGNMDTFTKIQRKDFAGLTFLEELEIDASDLQSYEPKSLKSIQNVSHLILHMKQH ILLLEIFVDVTSSVECLELRDTDLDTFHFSELSTGETNSLIKKFTFRNVKITDESLFQVMKLLNQISGLL ELEFDDCTLNGVGNFRASDNDRVIDPGKVETLTIRRLHIPRFYLFYDLSTLYSLTERVKRITVENSKVFL VPCLLSQHLKSLEYLDLSENLMVEEYLKNSACEDAWPSLQTLILRQNHLASLEKTGETLLTLKNLTNIDI SKNSFHSMPETCQWPEKMKYLNLSSTRIHSVTGCIPKTLEILDVSNNNLNLFSLNLPQLKELYISRNKLM TLPDASLLPMLLVLKISRNAITTFSKEQLDSFHTLKTLEAGGNNFICSCEFLSFTQEQQALAKVLIDWPA NYLCDSPSHVRGQQVQDVRLSVSECHRTALVSGMCCALFLLILLTGVLCHRFHGLWYMKMMWAWLQAKRK PRKAPSRNICYDAFVSYSERDAYWVENLMVQELENFNPPFKLCLHKRDFIPGKWIIDNIIDSIEKSHKTV FVLSENFVKSEWCKYELDFSHFRLFDENNDAAILILLEPIEKKAIPQRFCKLRKIMNTKTYLEWPMDEAQ REGFWVNLRAAIKSTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Transmembrane |
Protein Pathways : | Toll-like receptor signaling pathway |
Full Length : | Full L. |
Gene Name | TLR2 toll like receptor 2 [ Homo sapiens (human) ] |
Official Symbol | TLR2 |
Synonyms | TIL4; CD282 |
Gene ID | 7097 |
mRNA Refseq | NM_003264.5 |
Protein Refseq | NP_003255.2 |
MIM | 603028 |
UniProt ID | O60603 |
◆ Recombinant Proteins | ||
TLR2-3258H | Recombinant Human TLR2, GST-tagged | +Inquiry |
TLR2-5135H | Recombinant Human TLR2 Protein (Met1-Arg587), C-His tagged | +Inquiry |
Tlr2-7396M | Recombinant Mouse Tlr2 protein, His-tagged | +Inquiry |
RFL10018GF | Recombinant Full Length Giraffa Camelopardalis Toll-Like Receptor 2(Tlr2) Protein, His-Tagged | +Inquiry |
RFL7415HF | Recombinant Full Length Human Toll-Like Receptor 2(Tlr2) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TLR2-439HCL | Recombinant Human TLR2 cell lysate | +Inquiry |
TLR2-001RCL | Recombinant Rat TLR2 cell lysate | +Inquiry |
TLR2-001MCL | Recombinant Mouse TLR2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TLR2 Products
Required fields are marked with *
My Review for All TLR2 Products
Required fields are marked with *
0
Inquiry Basket