Recombinant Full Length Human TMEM159 Protein, GST-tagged

Cat.No. : TMEM159-5908HF
Product Overview : Human LOC57146 full-length ORF ( NP_065155.2, 1 a.a. - 161 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 161 amino acids
Description : TMEM159 (Transmembrane Protein 159) is a Protein Coding gene.
Molecular Mass : 43.9 kDa
AA Sequence : MAKEEPQSISRDLQELQKKLSLLIDSFQNNSKVVAFMKSPVGQYLDSHPFLAFTLLVFIVMSAVPVGFFLLIVVLTTLAALLGVIILEGLVISVGGFSLLCILCGLGFVSLAMSGMMIASYVVVSSLISCWFSPRPLTQQNTSCDFLPAMKSADFEGLYQE
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name TMEM159 transmembrane protein 159 [ Homo sapiens ]
Official Symbol TMEM159
Synonyms PROMETHIN; TMEM159; transmembrane protein 159
Gene ID 57146
mRNA Refseq NM_020422
Protein Refseq NP_065155
MIM 611304
UniProt ID Q96B96

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TMEM159 Products

Required fields are marked with *

My Review for All TMEM159 Products

Required fields are marked with *

0
cart-icon