Recombinant Human TMEM159 protein, GST-tagged
Cat.No. : | TMEM159-301371H |
Product Overview : | Recombinant Human TMEM159 (1-55 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Met1-Leu55 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | MAKEEPQSISRDLQELQKKLSLLIDSFQNNSKVVAFMKSPVGQYLDSHPFLAFTL |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | TMEM159 transmembrane protein 159 [ Homo sapiens ] |
Official Symbol | TMEM159 |
Synonyms | PROMETHIN |
Gene ID | 57146 |
mRNA Refseq | NM_020422.4 |
Protein Refseq | NP_065155.3 |
MIM | 611304 |
UniProt ID | Q96B96 |
◆ Recombinant Proteins | ||
RFL993MF | Recombinant Full Length Mouse Promethin(Tmem159) Protein, His-Tagged | +Inquiry |
TMEM159-16936M | Recombinant Mouse TMEM159 Protein | +Inquiry |
TMEM159-5908HF | Recombinant Full Length Human TMEM159 Protein, GST-tagged | +Inquiry |
RFL5908HF | Recombinant Full Length Human Promethin(Tmem159) Protein, His-Tagged | +Inquiry |
TMEM159-301371H | Recombinant Human TMEM159 protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TMEM159 Products
Required fields are marked with *
My Review for All TMEM159 Products
Required fields are marked with *
0
Inquiry Basket