Recombinant Full Length Human TMEM240 Protein, C-Flag-tagged

Cat.No. : TMEM240-824HFL
Product Overview : Recombinant Full Length Human TMEM240 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Mammalian Cells
Tag : Flag
Description : This gene encodes a transmembrane-domain containing protein found in the brain and cerebellum. Mutations in this gene result in spinocerebellar ataxia 21.
Form : 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
Molecular Mass : 19.7 kDa
AA Sequence : MSMSANTMIFMILGASVVMAIACLMDMNALLDRFHNYILPHLRGEDRVCHCNCGRHHIHYVIPYDGDQSV VDASENYFVTDSVTKQEIDLMLGLLLGFCISWFLVWMDGVLHCAVRAWRAGRRYDGSWTWLPKLCSLREL
GRRPHRPFEEAAGNMVHVKQKLYHNGHPSPRHLTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining.
Stability : Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Storage : Store at -80 centigrade.
Concentration : >50 ug/mL as determined by microplate BCA method.
Preparation : Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Full Length : Full L.
Gene Name TMEM240 transmembrane protein 240 [ Homo sapiens (human) ]
Official Symbol TMEM240
Synonyms SCA21; C1orf70
Gene ID 339453
mRNA Refseq NM_001114748.2
Protein Refseq NP_001108220.1
MIM 616101
UniProt ID Q5SV17

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TMEM240 Products

Required fields are marked with *

My Review for All TMEM240 Products

Required fields are marked with *

0
cart-icon