Recombinant Full Length Human TMEM240 Protein, C-Flag-tagged

• Cat.No.: TMEM240-824HFL
• Product Overview: Recombinant Full Length Human TMEM240 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.

Specification

• Species: Human
• Source: Mammalian Cells
• Tag: Flag
• Description: This gene encodes a transmembrane-domain containing protein found in the brain and cerebellum. Mutations in this gene result in spinocerebellar ataxia 21.
• Form: 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
• Molecular Mass: 19.7 kDa
• AA Sequence: MSMSANTMIFMILGASVVMAIACLMDMNALLDRFHNYILPHLRGEDRVCHCNCGRHHIHYVIPYDGDQSV VDASENYFVTDSVTKQEIDLMLGLLLGFCISWFLVWMDGVLHCAVRAWRAGRRYDGSWTWLPKLCSLREL
  GRRPHRPFEEAAGNMVHVKQKLYHNGHPSPRHLTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Storage: Store at -80 centigrade.
• Concentration: >50 ug/mL as determined by microplate BCA method.
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Full Length: Full L.

Gene Information

• Gene Name: TMEM240 transmembrane protein 240 [ Homo sapiens (human) ]
• Official Symbol: TMEM240
• Synonyms: SCA21; C1orf70
• Gene ID: 339453
• mRNA Refseq: NM_001114748.2
• Protein Refseq: NP_001108220.1
• MIM: 616101
• UniProt ID: Q5SV17