Recombinant Full Length Human TMPRSS2 Protein, GST-tagged
Cat.No. : | TMPRSS2-6852HF |
Product Overview : | Human TMPRSS2 full-length ORF ( AAH51839.1, 1 a.a. - 492 a.a.) recombinant protein with GST-tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 492 amino acids |
Description : | This gene encodes a protein that belongs to the serine protease family. The encoded protein contains a type II transmembrane domain, a receptor class A domain, a scavenger receptor cysteine-rich domain and a protease domain. Serine proteases are known to be involved in many physiological and pathological processes. This gene was demonstrated to be up-regulated by androgenic hormones in prostate cancer cells and down-regulated in androgen-independent prostate cancer tissue. The protease domain of this protein is thought to be cleaved and secreted into cell media after autocleavage. This protein also facilitates entry of viruses into host cells by proteolytically cleaving and activating viral envelope glycoproteins. Viruses found to use this protein for cell entry include Influenza virus and the human coronaviruses HCoV-229E, MERS-CoV, SARS-CoV and SARS-CoV-2 (COVID-19 virus). Alternatively spliced transcript variants encoding different isoforms have been found for this gene. |
Molecular Mass : | 79.86 kDa |
AA Sequence : | MALNSGSPPAIEPYYENHGYQPENPYPAQPTVVPTVYEVHPAQYYPSPVPQYAPRVLTQASDPVVCTQPKSPSGTVCTSKTKKALCITLTLGTFLVGAALAAGLLWKFMGSKCSNSGIECDSSGTCINPSNWCDGVSHCPGGEDENRCVRLYGPNFILQVYSSQRKSWHPVCQDDWNENYGRAACRDMGYKNNFYSSQGIVDDSGSTSFMKLNTSAGNVDIYKKLYHSDACSSKAVVSLRCIACGVNLNSSRQSRIVGGESALPGAWPWQVSLHVQNVHVCGGSIITPEWIVTAAHCVEKPLNNPWHWTAFAGILRQSFMFYGAGYQVEKVISHPNYDSKTKNNDIALMKLQKPLTFNDLVKPVCLPNPGMMLQPEQLCWISGWGATEEKGKTSEVLNAAKVLLIETQRCNSRYVYDNLITPAMICAGFLQGNVDSCQGDSGGPLVTSKNNIWWLIGDTSWGSGCAKAYRPGVYGNVMVFTDWIYRQMRADG |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | TMPRSS2 transmembrane serine protease 2 [ Homo sapiens (human) ] |
Official Symbol | TMPRSS2 |
Synonyms | TMPRSS2; transmembrane serine protease 2; PP9284; PRSS10; transmembrane protease serine 2; epitheliasin; serine protease 10; transmembrane protease, serine 2; NP_001128571.1; EC 3.4.21.-; EC 3.4.21.- |
Gene ID | 7113 |
mRNA Refseq | NM_005656 |
Protein Refseq | NP_005647 |
MIM | 602060 |
UniProt ID | O15393 |
◆ Recombinant Proteins | ||
TMPRSS2-4899H | Recombinant Human TMPRSS2 protein, His-tagged | +Inquiry |
TMPRSS2-02H | Active Recombinant Human TMPRSS2 Protein, His-tagged | +Inquiry |
TMPRSS2-4599H | Recombinant Human TMPRSS2 protein, His-sumostar-tagged | +Inquiry |
TMPRSS2-6852HF | Recombinant Full Length Human TMPRSS2 Protein, GST-tagged | +Inquiry |
TMPRSS2-30144TH | Recombinant Human TMPRSS2 | +Inquiry |
◆ Native Proteins | ||
TMPRSS2-011H | Recombinant Human TMPRSS3 Protein, His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TMPRSS2-910HCL | Recombinant Human TMPRSS2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TMPRSS2 Products
Required fields are marked with *
My Review for All TMPRSS2 Products
Required fields are marked with *