Recombinant Human TMPRSS2 protein, GST-tagged
| Cat.No. : | TMPRSS2-70H | 
| Product Overview : | Human TMPRSS2 full-length ORF ( AAH51839.1, 1 a.a. - 492 a.a.) recombinant protein with GST-tag at N-terminal was expressed in Wheat Germ. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | Wheat Germ | 
| Tag : | GST | 
| Molecular Mass : | 79.86 kDa | 
| AA Sequence : | MALNSGSPPAIEPYYENHGYQPENPYPAQPTVVPTVYEVHPAQYYPSPVPQYAPRVLTQASDPVVCTQPKSPSGTVCTSKTKKALCITLTLGTFLVGAALAAGLLWKFMGSKCSNSGIECDSSGTCINPSNWCDGVSHCPGGEDENRCVRLYGPNFILQVYSSQRKSWHPVCQDDWNENYGRAACRDMGYKNNFYSSQGIVDDSGSTSFMKLNTSAGNVDIYKKLYHSDACSSKAVVSLRCIACGVNLNSSRQSRIVGGESALPGAWPWQVSLHVQNVHVCGGSIITPEWIVTAAHCVEKPLNNPWHWTAFAGILRQSFMFYGAGYQVEKVISHPNYDSKTKNNDIALMKLQKPLTFNDLVKPVCLPNPGMMLQPEQLCWISGWGATEEKGKTSEVLNAAKVLLIETQRCNSRYVYDNLITPAMICAGFLQGNVDSCQGDSGGPLVTSKNNIWWLIGDTSWGSGCAKAYRPGVYGNVMVFTDWIYRQMRADG | 
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array | 
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. | 
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. | 
| Gene Name | TMPRSS2 transmembrane serine protease 2 [ Homo sapiens (human) ] | 
| Official Symbol | TMPRSS2 | 
| Synonyms | TMPRSS2; transmembrane serine protease 2; PP9284; PRSS10; transmembrane protease serine 2; epitheliasin; serine protease 10; transmembrane protease, serine 2; NP_001128571.1; EC 3.4.21.-; EC 3.4.21.- | 
| Gene ID | 7113 | 
| mRNA Refseq | NM_005656 | 
| Protein Refseq | NP_005647 | 
| MIM | 602060 | 
| UniProt ID | O15393 | 
| ◆ Recombinant Proteins | ||
| TMPRSS2-086H | Recombinant Human TMPRSS2 Protein, His-tagged | +Inquiry | 
| TMPRSS2-13H | Recombinant Active Human TMPRSS2 Protein (107-492), N-FLAG and C-Myc/His-tagged | +Inquiry | 
| TMPRSS2-427H | Recombinant Human TMPRSS2 Protein, His-tagged | +Inquiry | 
| TMPRSS2-1856H | Recombinant Human TMPRSS2 Protein (106-492 aa), His-tagged | +Inquiry | 
| TMPRSS2-30144TH | Recombinant Human TMPRSS2 | +Inquiry | 
| ◆ Native Proteins | ||
| TMPRSS2-011H | Recombinant Human TMPRSS3 Protein, His tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| TMPRSS2-910HCL | Recombinant Human TMPRSS2 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TMPRSS2 Products
Required fields are marked with *
My Review for All TMPRSS2 Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            