Recombinant Full Length Human TNNT2 Protein, C-Flag-tagged
Cat.No. : | TNNT2-897HFL |
Product Overview : | Recombinant Full Length Human TNNT2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes the cardiac isoform of troponin T. The encoded protein is the tropomyosin-binding subunit of the troponin complex, which is located on the thin filament of striated muscles and regulates muscle contraction in response to alterations in intracellular calcium ion concentration. Mutations in this gene have been associated with familial hypertrophic cardiomyopathy as well as with dilated cardiomyopathy. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 35.4 kDa |
AA Sequence : | MSDIEEVVEEYEEEEQEEAAVEEEEDWREDEDEQEEAAEEDAEAEAETEETRAEEDEEEEEAKEAEDGPM EESKPKPRSFMPNLVPPKIPDGERVDFDDIHRKRMEKDLNELQALIEAHFENRKKEEEELVSLKDRIERR RAERAEQQRIRNEREKERQNRLAEERARREEEENRRKAEDEARKKKALSNMMHFGGYIQKTERKSGKRQT EREKKKKILAERRKVLAIDHLNEDQLREKAKELWQSIYNLEAEKFDLQEKFKQQKYEINVLRNRINDNQK VSKTRGKAKVTGRWKTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Protein Pathways : | Cardiac muscle contraction, Dilated cardiomyopathy, Hypertrophic cardiomyopathy (HCM) |
Full Length : | Full L. |
Gene Name | TNNT2 troponin T2, cardiac type [ Homo sapiens (human) ] |
Official Symbol | TNNT2 |
Synonyms | CMH2; RCM3; TnTC; cTnT; CMD1D; CMPD2; LVNC6 |
Gene ID | 7139 |
mRNA Refseq | NM_000364.4 |
Protein Refseq | NP_000355.2 |
MIM | 191045 |
UniProt ID | P45379 |
◆ Recombinant Proteins | ||
TNNT2-7951P | Recombinant Pig TNNT2 protein, His & T7-tagged | +Inquiry |
TNNT2-5337H | Recombinant Human TNNT2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
TNNT2-7950H | Recombinant Human TNNT2 protein, His & GST-tagged | +Inquiry |
TNNT2-6211R | Recombinant Rat TNNT2 Protein | +Inquiry |
Tnnt2-4605R | Recombinant Rat Tnnt2 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
Tnnt2-7425M | Native Mouse Tnnt2 Protein | +Inquiry |
TNNT2-4655H | Native Human Troponin T Type 2 (Cardiac) | +Inquiry |
◆ Cell & Tissue Lysates | ||
TNNT2-880HCL | Recombinant Human TNNT2 293 Cell Lysate | +Inquiry |
TNNT2-879HCL | Recombinant Human TNNT2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TNNT2 Products
Required fields are marked with *
My Review for All TNNT2 Products
Required fields are marked with *
0
Inquiry Basket