Recombinant Full Length Human TOR1A Protein
| Cat.No. : | TOR1A-528HF |
| Product Overview : | Recombinant full length Human Torsin A with N-terminal proprietary tag.Mol Wt 62.63 kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Protein Length : | 332 amino acids |
| Description : | The protein encoded by this gene is a member of the AAA family of adenosine triphosphatases (ATPases), is related to the Clp protease/heat shock family and is expressed prominently in the substantia nigra pars compacta. Mutations in this gene result in the autosomal dominant disorder, torsion dystonia 1. |
| Form : | Liquid |
| Molecular Mass : | 62.630kDa inclusive of tags |
| AA Sequence : | MKLGRAVLGLLLLAPSVVQAVEPISLGLALAGVLTGYIYP RLYCLFAECCGQKRSLSREALQKDLDDNLFGQHLAKKIIL NAVFGFINNPKPKKPLTLSLHGWTGTGKNFVSKIIAENIY EGGLNSDYVHLFVATLHFPHASNITLYKDQLQLWIRGNVS ACARSIFIFDEMDKMHAGLIDAIKPFLDYYDLVDGVSYQK AMFIFLSNAGAERITDVALDFWRSGKQREDIKLKDIEHAL SVSVFNNKNSGFWHSSLIHRNLIDYFVPFLPLEYKHLKMC IRVEMQSRGYEIDEDIVSRVAEEMTFFPKEERVFSDKGCK TVFTKLDYYYDD |
| Purity : | Proprietary Purification |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
| Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
| Gene Name | TOR1A torsin family 1, member A (torsin A) [ Homo sapiens ] |
| Official Symbol | TOR1A |
| Synonyms | TOR1A; torsin family 1, member A (torsin A); dystonia 1, torsion (autosomal dominant; torsin A) , DYT1; torsin-1A; DQ2 |
| Gene ID | 1861 |
| mRNA Refseq | NM_000113 |
| Protein Refseq | NP_000104 |
| MIM | 605204 |
| UniProt ID | O14656 |
| ◆ Recombinant Proteins | ||
| TOR1A-536H | Recombinant Human torsin family 1, member A (torsin A), His-tagged | +Inquiry |
| TOR1A-3878H | Recombinant Human TOR1A protein, His-tagged | +Inquiry |
| Tor1a-543M | Recombinant Mouse Tor1a Protein, His-tagged | +Inquiry |
| TOR1A-29828TH | Recombinant Human TOR1A | +Inquiry |
| TOR1A-786C | Recombinant Cynomolgus Monkey TOR1A Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TOR1A-866HCL | Recombinant Human TOR1A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TOR1A Products
Required fields are marked with *
My Review for All TOR1A Products
Required fields are marked with *
