Recombinant Full Length Human TOX Protein, C-Flag-tagged
Cat.No. : | TOX-1411HFL |
Product Overview : | Recombinant Full Length Human TOX Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene contains a HMG box DNA binding domain. HMG boxes are found in many eukaryotic proteins involved in chromatin assembly, transcription and replication. This protein may function to regulate T-cell development. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 57.3 kDa |
AA Sequence : | MDVRFYPPVAQPAAAPDAPCLGPSPCLDPYYCNKFDGENMYMSMTEPSQDYVPASQSYPGPSLESEDFNI PPITPPSLPDHSLVHLNEVESGYHSLCHPMNHNGLLPFHPQNMDLPEITVSNMLGQDGTLLSNSISVMPD IRNPEGTQYSSHPQMAAMRPRGQPADIRQQPGMMPHGQLTTINQSQLSAQLGLNMGGSNVPHNSPSPPGS KSATPSPSSSVHEDEGDDTSKINGGEKRPASDMGKKPKTPKKKKKKDPNEPQKPVSAYALFFRDTQAAIK GQNPNATFGEVSKIVASMWDGLGEEQKQVYKKKTEAAKKEYLKQLAAYRASLVSKSYSEPVDVKTSQPPQ LINSKPSVFHGPSQAHSALYLSSHYHQQPGMNPHLTAMHPSLPRNIAPKPNNQMPVTVSIANMAVSPPPP LQISPPLHQHLNMQQHQPLTMQQPLGNQLPMQVQSALHSPTMQQGFTLQPDYQTIINPTSTAAQVVTQAM EYVRSGCRNPPPQPVDWNNDYCSSGGMQRDKALYLTTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Transcription Factors |
Full Length : | Full L. |
Gene Name | TOX thymocyte selection associated high mobility group box [ Homo sapiens (human) ] |
Official Symbol | TOX |
Synonyms | TOX1 |
Gene ID | 9760 |
mRNA Refseq | NM_014729.3 |
Protein Refseq | NP_055544.1 |
MIM | 606863 |
UniProt ID | O94900 |
◆ Recombinant Proteins | ||
TOX-4722R | Recombinant Rhesus Macaque TOX Protein, His (Fc)-Avi-tagged | +Inquiry |
TOX-2234H | Recombinant Human TOX Protein, His (Fc)-Avi-tagged | +Inquiry |
TOX-8190Z | Recombinant Zebrafish TOX | +Inquiry |
CRM197-2780C | Recombinant CRM197 | +Inquiry |
Tox-6588M | Recombinant Mouse Tox Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TOX-863HCL | Recombinant Human TOX 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TOX Products
Required fields are marked with *
My Review for All TOX Products
Required fields are marked with *
0
Inquiry Basket