Recombinant Full Length Human TPD52L3 Protein, GST-tagged
Cat.No. : | TPD52L3-6876HF |
Product Overview : | Human TPD52L3 full-length ORF ( NP_277051.3, 1 a.a. - 140 a.a.) recombinant protein with GST-tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 140 amino acids |
Description : | This gene encodes a member of the tumor protein D52-like family of proteins. These proteins are characterized by an N-terminal coiled-coil motif that is used to form homo- and heteromeric complexes with other tumor protein D52-like proteins. The encoded protein may play a role in spermatogenesis. Alternate splicing results in multiple transcript variants. |
Molecular Mass : | 41.9 kDa |
AA Sequence : | MPHARTETSVGTYESHSTSELEDLTEPEQRELKTKLTKLEAEIVTLRHVLAAKERRCGELKRKLGLTALVGLRQNLSKSWLDVQVSNTYVKQKTSAALSTMGTLICRKLGGVKKSATLRSFEGLMGTIKSKVSGGKRAWP |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | TPD52L3 TPD52 like 3 [ Homo sapiens (human) ] |
Official Symbol | TPD52L3 |
Synonyms | TPD52L3; TPD52 like 3; D55; hD55; TPD55; NYDSP25; tumor protein D55; protein kinase NYD-SP25; testis development protein NYD-SP25; testis tissue sperm-binding protein Li 87P; tumor protein D52 like 3 |
Gene ID | 89882 |
mRNA Refseq | NM_033516 |
Protein Refseq | NP_277051 |
MIM | 617567 |
UniProt ID | Q96J77 |
◆ Recombinant Proteins | ||
TPD52L3-01H | Recombinant Human TPD52L3 Protein, GST-tagged | +Inquiry |
TPD52L3-6876HF | Recombinant Full Length Human TPD52L3 Protein, GST-tagged | +Inquiry |
TPD52L3-3366H | Recombinant Human TPD52L3, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TPD52L3-849HCL | Recombinant Human TPD52L3 293 Cell Lysate | +Inquiry |
TPD52L3-848HCL | Recombinant Human TPD52L3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TPD52L3 Products
Required fields are marked with *
My Review for All TPD52L3 Products
Required fields are marked with *