Recombinant Human TPD52L3 Protein, GST-tagged

• Cat.No.: TPD52L3-01H
• Product Overview: Human TPD52L3 full-length ORF ( NP_277051.3, 1 a.a. - 140 a.a.) recombinant protein with GST-tag at N-terminal was expressed in Wheat Germ.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a member of the tumor protein D52-like family of proteins. These proteins are characterized by an N-terminal coiled-coil motif that is used to form homo- and heteromeric complexes with other tumor protein D52-like proteins. The encoded protein may play a role in spermatogenesis. Alternate splicing results in multiple transcript variants.
• Molecular Mass: 41.9 kDa
• AA Sequence: MPHARTETSVGTYESHSTSELEDLTEPEQRELKTKLTKLEAEIVTLRHVLAAKERRCGELKRKLGLTALVGLRQNLSKSWLDVQVSNTYVKQKTSAALSTMGTLICRKLGGVKKSATLRSFEGLMGTIKSKVSGGKRAWP
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: TPD52L3 TPD52 like 3 [ Homo sapiens (human) ]
• Official Symbol: TPD52L3
• Synonyms: TPD52L3; TPD52 like 3; D55; hD55; TPD55; NYDSP25; tumor protein D55; protein kinase NYD-SP25; testis development protein NYD-SP25; testis tissue sperm-binding protein Li 87P; tumor protein D52 like 3
• Gene ID: 89882
• mRNA Refseq: NM_033516
• Protein Refseq: NP_277051
• MIM: 617567
• UniProt ID: Q96J77