Recombinant Full Length Human TPK1 Protein, C-Flag-tagged

• Cat.No.: TPK1-1112HFL
• Product Overview: Recombinant Full Length Human TPK1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.

Specification

• Species: Human
• Source: Mammalian Cells
• Tag: Flag
• Description: The protein encoded by this gene functions as a homodimer and catalyzes the conversion of thiamine to thiamine pyrophosphate, a cofactor for some enzymes of the glycolytic and energy production pathways. Defects in this gene are a cause of thiamine metabolism dysfunction syndrome-5.
• Form: 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
• Molecular Mass: 27.1 kDa
• AA Sequence: MEHAFTPLEPLLSTGNLKYCLVILNQPLDNYFRHLWNKALLRACADGGANRLYDITEGERESFLPEFING DFDSIRPEVREYYATKGCELISTPDQDHTDFTKCLKMLQKKIEEKDLKVDVIVTLGGLAGRFDQIMASVN TLFQATHITPFPIIIIQEESLIYLLQPGKHRLHVDTGMEGDWCGLIPVGQPCSQVTTTGLKWNLTNDVLA
  FGTLVSTSNTYDGSGVVTVETDHPLLWTMAIKSTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Storage: Store at -80 centigrade.
• Concentration: >50 ug/mL as determined by microplate BCA method.
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Protein Families: Druggable Genome
• Protein Pathways: Metabolic pathways, Thiamine metabolism
• Full Length: Full L.

Gene Information

• Gene Name: TPK1 thiamin pyrophosphokinase 1 [ Homo sapiens (human) ]
• Official Symbol: TPK1
• Synonyms: PP20; HTPK1; THMD5
• Gene ID: 27010
• mRNA Refseq: NM_022445.4
• Protein Refseq: NP_071890.2
• MIM: 606370
• UniProt ID: Q9H3S4