Recombinant Full Length Human TPK1 Protein, C-Flag-tagged
Cat.No. : | TPK1-1112HFL |
Product Overview : | Recombinant Full Length Human TPK1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene functions as a homodimer and catalyzes the conversion of thiamine to thiamine pyrophosphate, a cofactor for some enzymes of the glycolytic and energy production pathways. Defects in this gene are a cause of thiamine metabolism dysfunction syndrome-5. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 27.1 kDa |
AA Sequence : | MEHAFTPLEPLLSTGNLKYCLVILNQPLDNYFRHLWNKALLRACADGGANRLYDITEGERESFLPEFING DFDSIRPEVREYYATKGCELISTPDQDHTDFTKCLKMLQKKIEEKDLKVDVIVTLGGLAGRFDQIMASVN TLFQATHITPFPIIIIQEESLIYLLQPGKHRLHVDTGMEGDWCGLIPVGQPCSQVTTTGLKWNLTNDVLA FGTLVSTSNTYDGSGVVTVETDHPLLWTMAIKSTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Protein Pathways : | Metabolic pathways, Thiamine metabolism |
Full Length : | Full L. |
Gene Name | TPK1 thiamin pyrophosphokinase 1 [ Homo sapiens (human) ] |
Official Symbol | TPK1 |
Synonyms | PP20; HTPK1; THMD5 |
Gene ID | 27010 |
mRNA Refseq | NM_022445.4 |
Protein Refseq | NP_071890.2 |
MIM | 606370 |
UniProt ID | Q9H3S4 |
◆ Recombinant Proteins | ||
TPK1-17255M | Recombinant Mouse TPK1 Protein | +Inquiry |
RFL30684AF | Recombinant Full Length Arabidopsis Thaliana Calcium-Activated Outward-Rectifying Potassium Channel 1(Kco1) Protein, His-Tagged | +Inquiry |
TPK1-9535M | Recombinant Mouse TPK1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Tpk1-6597M | Recombinant Mouse Tpk1 Protein, Myc/DDK-tagged | +Inquiry |
TPK1-1112HFL | Recombinant Full Length Human TPK1 Protein, C-Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TPK1-845HCL | Recombinant Human TPK1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TPK1 Products
Required fields are marked with *
My Review for All TPK1 Products
Required fields are marked with *