Recombinant Full Length Human Translocon-Associated Protein Subunit Beta(Ssr2) Protein, His-Tagged
Cat.No. : | RFL14793HF |
Product Overview : | Recombinant Full Length Human Translocon-associated protein subunit beta(SSR2) Protein (P43308) (18-183aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (18-183) |
Form : | Lyophilized powder |
AA Sequence : | EEGARLLASKSLLNRYAVEGRDLTLQYNIYNVGSSAALDVELSDDSFPPEDFGIVSGMLNVKWDRIAPASNVSHTVVLRPLKAGYFNFTSATITYLAQEDGPVVIGSTSAPGQGGILAQREFDRRFSPHFLDWAAFGVMTLPSIGIPLLLWYSSKRKYDTPKTKKN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | SSR2 |
Synonyms | SSR2; TRAPB; HSD25; Translocon-associated protein subunit beta; TRAP-beta; Signal sequence receptor subunit beta; SSR-beta |
UniProt ID | P43308 |
◆ Recombinant Proteins | ||
SSR2-1698C | Recombinant Chicken SSR2 | +Inquiry |
SSR2-204Z | Recombinant Zebrafish SSR2 | +Inquiry |
SSR2-8748M | Recombinant Mouse SSR2 Protein, His (Fc)-Avi-tagged | +Inquiry |
SSR2-3390H | Recombinant Human SSR2, His-tagged | +Inquiry |
SSR2-4306R | Recombinant Rhesus Macaque SSR2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SSR2-1698HCL | Recombinant Human SSR2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SSR2 Products
Required fields are marked with *
My Review for All SSR2 Products
Required fields are marked with *
0
Inquiry Basket