Recombinant Full Length Human Transmembrane 4 L6 Family Member 19(Tm4Sf19) Protein, His-Tagged
Cat.No. : | RFL18581HF |
Product Overview : | Recombinant Full Length Human Transmembrane 4 L6 family member 19(TM4SF19) Protein (Q96DZ7) (1-209aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-209) |
Form : | Lyophilized powder |
AA Sequence : | MVSSPCTQASSRTCSRILGLSLGTAALFAAGANVALLLPNWDVTYLLRGLLGRHAMLGTG LWGGGLMVLTAAILISLMGWRYGCFSKSGLCRSVLTALLSGGLALLGALICFVTSGVALK DGPFCMFDVSSFNQTQAWKYGYPFKDLHSRNYLYDRSLWNSVCLEPSAAVVWHVSLFSAL LCISLLQLLLVVVHVINSLLGLFCSLCEK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | TM4SF19 |
Synonyms | TM4SF19; OCTM4; Transmembrane 4 L6 family member 19; Osteoclast maturation-associated gene 4 protein; Tetraspan membrane protein OCTM4 |
UniProt ID | Q96DZ7 |
◆ Recombinant Proteins | ||
TM4SF19-4742R | Recombinant Rhesus monkey TM4SF19 Protein, His-tagged | +Inquiry |
TM4SF19-1031H | Recombinant Human TM4SF19 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
RFL18581HF | Recombinant Full Length Human Transmembrane 4 L6 Family Member 19(Tm4Sf19) Protein, His-Tagged | +Inquiry |
TM4SF19-4556R | Recombinant Rhesus Macaque TM4SF19 Protein, His (Fc)-Avi-tagged | +Inquiry |
TM4SF19-4836C | Recombinant Chicken TM4SF19 | +Inquiry |
◆ Cell & Tissue Lysates | ||
TM4SF19-1036HCL | Recombinant Human TM4SF19 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TM4SF19 Products
Required fields are marked with *
My Review for All TM4SF19 Products
Required fields are marked with *
0
Inquiry Basket