Recombinant Human TM4SF19 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : TM4SF19-1031H
Product Overview : TM4SF19 MS Standard C13 and N15-labeled recombinant protein (NP_612470) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : The protein encoded by this gene is a member of the four-transmembrane L6 superfamily. Members of this family function in various cellular processes including cell proliferation, motility, and adhesion via their interactions with integrins. In human brain tissue, this gene is expressed at high levels in the parietal lobe, occipital lobe, hippocampus, pons, white matter, corpus callosum, and cerebellum. Alternative splicing results in multiple transcript variants encoding different isoforms.
Molecular Mass : 22.3 kDa
AA Sequence : MVSSPCTPASSRTCSRILGLSLGTAALFAAGANVALLLPNWDVTYLLRGLLGRHAMLGTGLWGGGLMVLTAAILISLMGWRYGCFSKSGLCRSVLTALLSGGLALLGALICFVTSGVALKDGPFCMFDVSSFNQTQAWKYGYPFKDLHSRNYLYDRSLWNSVCLEPSAAVVWHVSLFSALLCISLLQLLLVVVHVINSLLGLFCSLCEKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name TM4SF19 transmembrane 4 L six family member 19 [ Homo sapiens (human) ]
Official Symbol TM4SF19
Synonyms TM4SF19; transmembrane 4 L six family member 19; OCTM4; transmembrane 4 L6 family member 19; osteoclast maturation-associated gene 4 protein; tetraspan membrane protein OCTM4
Gene ID 116211
mRNA Refseq NM_138461
Protein Refseq NP_612470
UniProt ID Q96DZ7

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TM4SF19 Products

Required fields are marked with *

My Review for All TM4SF19 Products

Required fields are marked with *

0
cart-icon