Recombinant Full Length Human Transmembrane Protein 70, Mitochondrial(Tmem70) Protein, His-Tagged
Cat.No. : | RFL19764HF |
Product Overview : | Recombinant Full Length Human Transmembrane protein 70, mitochondrial(TMEM70) Protein (Q9BUB7) (82-260aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (82-260) |
Form : | Lyophilized powder |
AA Sequence : | LNTPSDKSEDGRLIYTGNMARAVFGVKCFSYSTSLIGLTFLPYIFTQNNAISESVPLPIQ IIFYGIMGSFTVITPVLLHFITKGYVIRLYHEATTDTYKAITYNAMLAETSTVFHQNDVK IPDAKHVFTTFYAKTKSLLVNPVLFPNREDYIHLMGYDKEEFILYMEETSEEKRHKDDK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | TMEM70 |
Synonyms | TMEM70; Transmembrane protein 70, mitochondrial |
UniProt ID | Q9BUB7 |
◆ Recombinant Proteins | ||
RFL20901GF | Recombinant Full Length Chicken Transmembrane Protein 70, Mitochondrial(Tmem70) Protein, His-Tagged | +Inquiry |
TMEM70-4643H | Recombinant Human TMEM70 protein, His-tagged | +Inquiry |
TMEM70-2071C | Recombinant Chicken TMEM70 | +Inquiry |
TMEM70-4652R | Recombinant Rhesus Macaque TMEM70 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL15815BF | Recombinant Full Length Bovine Transmembrane Protein 70, Mitochondrial(Tmem70) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TMEM70-934HCL | Recombinant Human TMEM70 293 Cell Lysate | +Inquiry |
TMEM70-935HCL | Recombinant Human TMEM70 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TMEM70 Products
Required fields are marked with *
My Review for All TMEM70 Products
Required fields are marked with *