Recombinant Full Length Human Tumor Necrosis Factor Ligand Superfamily Member 8(Tnfsf8) Protein, His-Tagged
Cat.No. : | RFL13162HF |
Product Overview : | Recombinant Full Length Human Tumor necrosis factor ligand superfamily member 8(TNFSF8) Protein (P32971) (1-234aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-234) |
Form : | Lyophilized powder |
AA Sequence : | MDPGLQQALNGMAPPGDTAMHVPAGSVASHLGTTSRSYFYLTTATLALCLVFTVATIMVLVVQRTDSIPNSPDNVPLKGGNCSEDLLCILKRAPFKKSWAYLQVAKHLNKTKLSWNKDGILHGVRYQDGNLVIQFPGLYFIICQLQFLVQCPNNSVDLKLELLINKHIKKQALVTVCESGMQTKHVYQNLSQFLLDYLQVNTTISVNVDTFQYIDTSTFPLENVLSIFLYSNSD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | TNFSF8 |
Synonyms | TNFSF8; CD30L; CD30LG; Tumor necrosis factor ligand superfamily member 8; CD30 ligand; CD30-L; CD antigen CD153 |
UniProt ID | P32971 |
◆ Recombinant Proteins | ||
TNFSF8-015H | Recombinant Human TNFSF8 Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
TNFSF8-570H | Active Recombinant Human TNFSF8, Fc-tagged, Biotinylated | +Inquiry |
TNFSF8-15H | Recombinant Human TNFSF8 Protein (N165A), His-tagged | +Inquiry |
TNFSF8-9487M | Recombinant Mouse TNFSF8 Protein, His (Fc)-Avi-tagged | +Inquiry |
TNFSF8-18H | Recombinant Human TNFSF8 Protein (Y126A), His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TNFSF8-1190CCL | Recombinant Cynomolgus TNFSF8 cell lysate | +Inquiry |
TNFSF8-3051HCL | Recombinant Human TNFSF8 cell lysate | +Inquiry |
TNFSF8-1053RCL | Recombinant Rat TNFSF8 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TNFSF8 Products
Required fields are marked with *
My Review for All TNFSF8 Products
Required fields are marked with *
0
Inquiry Basket