Recombinant Human TNFSF8 Protein (D234A), His-tagged

Cat.No. : TNFSF8-13H
Product Overview : Recombinant Human TNFSF8 Protein (D234A) with a His tag was expressed in HEK293.
Availability May 01, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His
Description : The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This cytokine is a ligand for TNFRSF8/CD30, which is a cell surface antigen and a marker for Hodgkin lymphoma and related hematologic malignancies. The engagement of this cytokine expressed on B cell surface plays an inhibitory role in modulating Ig class switch. This cytokine was shown to enhance cell proliferation of some lymphoma cell lines, while to induce cell death and reduce cell proliferation of other lymphoma cell lines. The pleiotropic biologic activities of this cytokine on different CD30+ lymphoma cell lines may play a pathophysiologic role in Hodgkin's and some non-Hodgkin's lymphomas. Two transcript variants encoding different isoforms have been found for this gene.
Form : Lyophilized
Molecular Mass : The protein has a calculated MW of 22.3 kDa.
AA Sequence : MHHHHHHHHHHGGGSGGGSGGGSIEGRQRTDSIPNSPDNVPLKGGNCSEDLLCILKRAPFKKSWAYLQVAKHLNKTKLSWNKDGILHGVRYQDGNLVIQFPGLYFIICQLQFLVQCPNNSVDLKLELLINKHIKKQALVTVCESGMQTKHVYQNLSQFLLDYLQVNTTISVNVDTFQYIDTSTFPLENVLSIFLYSNSA
Endotoxin : <1 EU/μg
Purity : >90% by SDS-PAGE
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Storage Buffer : PBS pH7.4
Gene Name TNFSF8 TNF superfamily member 8 [ Homo sapiens (human) ]
Official Symbol TNFSF8
Synonyms TNFSF8; TNF superfamily member 8; tumor necrosis factor ligand superfamily member 8; CD153 antigen; CD30 antigen ligand; CD30 ligand; CD30-L; tumor necrosis factor (ligand) superfamily, member 8; tumor necrosis factor ligand 3A; tumor necrosis factor superfamily member 8
Gene ID 944
mRNA Refseq NM_001244
Protein Refseq NP_001235
MIM 603875
UniProt ID P32971

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All TNFSF8 Products

Required fields are marked with *

My Review for All TNFSF8 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon