Recombinant Full Length Human Tumor Necrosis Factor Receptor Superfamily Member 13B(Tnfrsf13B) Protein, His-Tagged
Cat.No. : | RFL24729HF |
Product Overview : | Recombinant Full Length Human Tumor necrosis factor receptor superfamily member 13B(TNFRSF13B) Protein (O14836) (1-293aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-293) |
Form : | Lyophilized powder |
AA Sequence : | MSGLGRSRRGGRSRVDQEERFPQGLWTGVAMRSCPEEQYWDPLLGTCMSCKTICNHQSQRTCAAFCRSLSCRKEQGKFYDHLLRDCISCASICGQHPKQCAYFCENKLRSPVNLPPELRRQRSGEVENNSDNSGRYQGLEHRGSEASPALPGLKLSADQVALVYSTLGLCLCAVLCCFLVAVACFLKKRGDPCSCQPRSRPRQSPAKSSQDHAMEAGSPVSTSPEPVETCSFCFPECRAPTQESAVTPGTPDPTCAGRWGCHTRTTVLQPCPHIPDSGLGIVCVPAQEGGPGA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | TNFRSF13B |
Synonyms | TNFRSF13B; TACI; Tumor necrosis factor receptor superfamily member 13B; Transmembrane activator and CAML interactor; CD antigen CD267 |
UniProt ID | O14836 |
◆ Recombinant Proteins | ||
TNFRSF13B-0805H | Active Recombinant Human TNFRSF13B protein, His-tagged | +Inquiry |
TNFRSF13B-506H | Active Recombinant Human TNFRSF13B protein, Fc-tagged | +Inquiry |
TNFRSF13B-7545H | Recombinant Human TNFRSF13B, His-tagged | +Inquiry |
TNFRSF13B-3320H | Recombinant Human TNFRSF13B, GST-tagged | +Inquiry |
RFL24729HF | Recombinant Full Length Human Tumor Necrosis Factor Receptor Superfamily Member 13B(Tnfrsf13B) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TNFRSF13B-1916HCL | Recombinant Human TNFRSF13B cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TNFRSF13B Products
Required fields are marked with *
My Review for All TNFRSF13B Products
Required fields are marked with *