Recombinant Full Length Human Tumor Necrosis Factor Receptor Superfamily Member 5(Cd40) Protein, His-Tagged
Cat.No. : | RFL32571HF |
Product Overview : | Recombinant Full Length Human Tumor necrosis factor receptor superfamily member 5(CD40) Protein (P25942) (21-277aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (21-277) |
Form : | Lyophilized powder |
AA Sequence : | EPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLRALVVIPIIFGILFAILLVLVFIKKVAKKPTNKAPHPKQEPQEINFPDDLPGSNTAAPVQETLHGCQPVTQEDGKESRISVQERQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | CD40 |
Synonyms | CD40; TNFRSF5; Tumor necrosis factor receptor superfamily member 5; B-cell surface antigen CD40; Bp50; CD40L receptor; CDw40; CD antigen CD40 |
UniProt ID | P25942 |
◆ Recombinant Proteins | ||
CD40-105H | Active Recombinant Human CD40, MIgG2a Fc-tagged | +Inquiry |
CD40-167C | Recombinant Canine CD40, Fc tagged | +Inquiry |
CD40-3237HF | Recombinant Full Length Human CD40 Protein, GST-tagged | +Inquiry |
CD40-628H | Recombinant Human CD40 Protein | +Inquiry |
CD40-32H | Recombinant Human CD40 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD40-001CCL | Recombinant Canine CD40 cell lysate | +Inquiry |
CD40-1254CCL | Recombinant Cynomolgus CD40 cell lysate | +Inquiry |
CD40-1831MCL | Recombinant Mouse CD40 cell lysate | +Inquiry |
CD40-1262RCL | Recombinant Rat CD40 cell lysate | +Inquiry |
CD40-2617HCL | Recombinant Human CD40 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD40 Products
Required fields are marked with *
My Review for All CD40 Products
Required fields are marked with *
0
Inquiry Basket