Recombinant Full Length Human UBR7 Protein, C-Flag-tagged
Cat.No. : | UBR7-608HFL |
Product Overview : | Recombinant Full Length Human UBR7 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a UBR box-containing protein that belongs to the E3 ubiquitin ligase family. The protein also contains a plant homeodomain (PHD) in the C-terminus. In mammals, the encoded protein recognizes N-degrons, the destabilizing N-terminal residues of short-lived proteins, which results in ubiquitinylation, and proteolysis via the proteasome. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 47.8 kDa |
AA Sequence : | MAGAEGAAGRQSELEPVVSLVDVLEEDEELENEACAVLGGSDSEKCSYSQGSVKRQALYACSTCTPEGEE PAGICLACSYECHGSHKLFELYTKRNFRCDCGNSKFKNLECKLLPDKAKVNSGNKYNDNFFGLYCICKRP YPDPEDEIPDEMIQCVVCEDWFHGRHLGAIPPESGDFQEMVCQACMKRCSFLWAYAAQLAVTKISTEDDG LVRNIDGIGDQEVIKPENGEHQDSTLKEDVPEQGKDDVREVKVEQNSEPCAGSSSESDLQTVFKNESLNA ESKSGCKLQELKAKQLIKKDTATYWPLNWRSKLCTCQDCMKMYGDLDVLFLTDEYDTVLAYENKGKIAQA TDRSDPLMDTLSSMNRVQQVELICEYNDLKTELKDYLKRFADEGTVVKREDIQQFFEEFQSKKRRRVDGM QYYCSTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Full Length : | Full L. |
Gene Name | UBR7 ubiquitin protein ligase E3 component n-recognin 7 [ Homo sapiens (human) ] |
Official Symbol | UBR7 |
Synonyms | LICAS; C14orf130 |
Gene ID | 55148 |
mRNA Refseq | NM_175748.4 |
Protein Refseq | NP_786924.2 |
MIM | 613816 |
UniProt ID | Q8N806 |
◆ Recombinant Proteins | ||
UBR7-5080R | Recombinant Rhesus monkey UBR7 Protein, His-tagged | +Inquiry |
UBR7-11907Z | Recombinant Zebrafish UBR7 | +Inquiry |
UBR7-3563H | Recombinant Human UBR7 protein, His-tagged | +Inquiry |
UBR7-4043H | Recombinant Human UBR7 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
UBR7-2301H | Recombinant Human UBR7 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
UBR7-203HCL | Recombinant Human UBR7 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All UBR7 Products
Required fields are marked with *
My Review for All UBR7 Products
Required fields are marked with *
0
Inquiry Basket