Recombinant Full Length Human UBTD2 Protein, GST-tagged

• Cat.No.: UBTD2-2408HF
• Product Overview: Human DC-UbP full-length ORF ( AAH19910, 1 a.a. - 190 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 190 amino acids
• Description: UBTD2 (Ubiquitin Domain Containing 2) is a Protein Coding gene. An important paralog of this gene is UBTD1.
• Molecular Mass: 46.64 kDa
• AA Sequence: MTDGQLRSKRDEFWDTAPAFEGRKEIWDALKAAAHAFESNDHELAQAIIDGANITLPHGALTECYDELGNRYQLPVYCLAPPINMIEEKSDIETLDIPEPPPNSGYECQLRLRLSTGKDLKLVVRSTDTVFHMKRRLHAAEGVEPGSQRWFFSGRPLTDKMKFEELKIPKDYVVQVIVSQPVQNPTPVEN
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: UBTD2 ubiquitin domain containing 2 [ Homo sapiens ]
• Official Symbol: UBTD2
• Synonyms: UBTD2; ubiquitin domain containing 2; ubiquitin domain-containing protein 2; DC UbP; dendritic cell derived ubiquitin like protein; MGC30022; ubiquitin-like protein SB72; DCUBP
• Gene ID: 92181
• mRNA Refseq: NM_152277
• Protein Refseq: NP_689490
• MIM: 610174
• UniProt ID: Q8WUN7