Recombinant Human UBTD2 Protein, GST-tagged
| Cat.No. : | UBTD2-2417H |
| Product Overview : | Human DC-UbP full-length ORF ( AAH19910, 1 a.a. - 190 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Protein Length : | 1-190 a.a. |
| Description : | UBTD2 (Ubiquitin Domain Containing 2) is a Protein Coding gene. An important paralog of this gene is UBTD1. |
| Molecular Mass : | 46.64 kDa |
| AA Sequence : | MTDGQLRSKRDEFWDTAPAFEGRKEIWDALKAAAHAFESNDHELAQAIIDGANITLPHGALTECYDELGNRYQLPVYCLAPPINMIEEKSDIETLDIPEPPPNSGYECQLRLRLSTGKDLKLVVRSTDTVFHMKRRLHAAEGVEPGSQRWFFSGRPLTDKMKFEELKIPKDYVVQVIVSQPVQNPTPVEN |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | UBTD2 ubiquitin domain containing 2 [ Homo sapiens ] |
| Official Symbol | UBTD2 |
| Synonyms | UBTD2; ubiquitin domain containing 2; ubiquitin domain-containing protein 2; DC UbP; dendritic cell derived ubiquitin like protein; MGC30022; ubiquitin-like protein SB72; DCUBP; |
| Gene ID | 92181 |
| mRNA Refseq | NM_152277 |
| Protein Refseq | NP_689490 |
| MIM | 610174 |
| UniProt ID | Q8WUN7 |
| ◆ Recombinant Proteins | ||
| UBTD2-3564H | Recombinant Human UBTD2, GST-tagged | +Inquiry |
| UBTD2-110H | Recombinant Human UBTD2 protein, His-tagged | +Inquiry |
| UBTD2-818Z | Recombinant Zebrafish UBTD2 | +Inquiry |
| UBTD2-2417H | Recombinant Human UBTD2 Protein, GST-tagged | +Inquiry |
| UBTD2-4895R | Recombinant Rhesus Macaque UBTD2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| UBTD2-542HCL | Recombinant Human UBTD2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All UBTD2 Products
Required fields are marked with *
My Review for All UBTD2 Products
Required fields are marked with *
