Recombinant Human UBTD2 Protein, GST-tagged

Cat.No. : UBTD2-2417H
Product Overview : Human DC-UbP full-length ORF ( AAH19910, 1 a.a. - 190 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Protein Length : 1-190 a.a.
Description : UBTD2 (Ubiquitin Domain Containing 2) is a Protein Coding gene. An important paralog of this gene is UBTD1.
Molecular Mass : 46.64 kDa
AA Sequence : MTDGQLRSKRDEFWDTAPAFEGRKEIWDALKAAAHAFESNDHELAQAIIDGANITLPHGALTECYDELGNRYQLPVYCLAPPINMIEEKSDIETLDIPEPPPNSGYECQLRLRLSTGKDLKLVVRSTDTVFHMKRRLHAAEGVEPGSQRWFFSGRPLTDKMKFEELKIPKDYVVQVIVSQPVQNPTPVEN
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name UBTD2 ubiquitin domain containing 2 [ Homo sapiens ]
Official Symbol UBTD2
Synonyms UBTD2; ubiquitin domain containing 2; ubiquitin domain-containing protein 2; DC UbP; dendritic cell derived ubiquitin like protein; MGC30022; ubiquitin-like protein SB72; DCUBP;
Gene ID 92181
mRNA Refseq NM_152277
Protein Refseq NP_689490
MIM 610174
UniProt ID Q8WUN7

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All UBTD2 Products

Required fields are marked with *

My Review for All UBTD2 Products

Required fields are marked with *

0
cart-icon