Recombinant Full Length Human UCHL1 Protein, C-Flag-tagged
Cat.No. : | UCHL1-01HFL |
Product Overview : | Recombinant Full Length Human UCHL1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene belongs to the peptidase C12 family. This enzyme is a thiol protease that hydrolyzes a peptide bond at the C-terminal glycine of ubiquitin. This gene is specifically expressed in the neurons and in cells of the diffuse neuroendocrine system. Mutations in this gene may be associated with Parkinson disease. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 24.6 kDa |
AA Sequence : | MQLKPMEINPEMLNKVLSRLGVAGQWRFVDVLGLEEESLGSVPAPACALLLLFPLTAQHENFRKKQIEEL KGQEVSPKVYFMKQTIGNSCGTIGLIHAVANNQDKLGFEDGSVLKQFLSETEKMSPEDRAKCFEKNEAIQ AAHDAVAQEGQCRVDDKVNFHFILFNNVDGHLYELDGRMPFPVNHGASSEDTLLKDAAKVCREFTEREQGEVRFSAVALCKAATRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Protease |
Protein Pathways : | Parkinson's disease |
Full Length : | Full L. |
Gene Name | UCHL1 ubiquitin C-terminal hydrolase L1 [ Homo sapiens (human) ] |
Official Symbol | UCHL1 |
Synonyms | HEL-117; HEL-S-53; NDGOA; PARK5; PGP 9.5; PGP9.5; PGP95; SPG79; Uch-L1 |
Gene ID | 7345 |
mRNA Refseq | NM_004181.5 |
Protein Refseq | NP_004172 |
MIM | 191342 |
UniProt ID | P09936 |
◆ Recombinant Proteins | ||
UCHL1-3608C | Recombinant Chicken UCHL1 | +Inquiry |
UCHL1-3091H | Recombinant Full Length Human?UCHL1 protein | +Inquiry |
UCHL1-1340S | Recombinant Human UCHL1 Protein (Q2-A223), Tag Free | +Inquiry |
UCHL1-20H | Recombinant Human UCHL1 Protein, Myc/DDK-tagged | +Inquiry |
UCHL1-01HFL | Recombinant Full Length Human UCHL1 Protein, C-Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
UCHL1-535HCL | Recombinant Human UCHL1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All UCHL1 Products
Required fields are marked with *
My Review for All UCHL1 Products
Required fields are marked with *
0
Inquiry Basket