Recombinant Full Length Human Udp-Glucuronosyltransferase 2B7(Ugt2B7) Protein, His-Tagged
Cat.No. : | RFL23893HF |
Product Overview : | Recombinant Full Length Human UDP-glucuronosyltransferase 2B7(UGT2B7) Protein (P16662) (24-529aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (24-529) |
Form : | Lyophilized powder |
AA Sequence : | GKVLVWAAEYSHWMNIKTILDELIQRGHEVTVLASSASILFDPNNSSALKIEIYPTSLTKTELENFIMQQIKRWSDLPKDTFWLYFSQVQEIMSIFGDITRKFCKDVVSNKKFMKKVQESRFDVIFADAIFPCSELLAELFNIPFVYSLSFSPGYTFEKHSGGFIFPPSYVPVVMSELTDQMTFMERVKNMIYVLYFDFWFEIFDMKKWDQFYSEVLGRPTTLSETMGKADVWLIRNSWNFQFPHPLLPNVDFVGGLHCKPAKPLPKEMEDFVQSSGENGVVVFSLGSMVSNMTEERANVIASALAQIPQKVLWRFDGNKPDTLGLNTRLYKWIPQNDLLGHPKTRAFITHGGANGIYEAIYHGIPMVGIPLFADQPDNIAHMKARGAAVRVDFNTMSSTDLLNALKRVINDPSYKENVMKLSRIQHDQPVKPLDRAVFWIEFVMRHKGAKHLRVAAHDLTWFQYHSLDVIGFLLVCVATVIFIVTKCCLFCFWKFARKAKKGKND |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | UGT2B7 |
Synonyms | UGT2B7; UGTB2B9; UDP-glucuronosyltransferase 2B7; UDPGT 2B7; UGT2B7; 3,4-catechol estrogen-specific UDPGT; UDP-glucuronosyltransferase 2B9; UDPGT 2B9; UDPGTh-2 |
UniProt ID | P16662 |
◆ Recombinant Proteins | ||
Ugt2b7-604R | Recombinant Rat Ugt2b7 Protein, His-tagged | +Inquiry |
RFL23893HF | Recombinant Full Length Human Udp-Glucuronosyltransferase 2B7(Ugt2B7) Protein, His-Tagged | +Inquiry |
UGT2B7-542HF | Recombinant Full Length Human UGT2B7 Protein, GST-tagged | +Inquiry |
UGT2B7-6436R | Recombinant Rat UGT2B7 Protein | +Inquiry |
RFL26914RF | Recombinant Full Length Rat Udp-Glucuronosyltransferase 2B7(Ugt2B7) Protein, His-Tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All UGT2B7 Products
Required fields are marked with *
My Review for All UGT2B7 Products
Required fields are marked with *
0
Inquiry Basket