Recombinant Full Length Human UGP2 Protein, C-Flag-tagged
Cat.No. : | UGP2-788HFL |
Product Overview : | Recombinant Full Length Human UGP2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The enzyme encoded by this gene is an important intermediary in mammalian carbohydrate interconversions. It transfers a glucose moiety from glucose-1-phosphate to MgUTP and forms UDP-glucose and MgPPi. In liver and muscle tissue, UDP-glucose is a direct precursor of glycogen; in lactating mammary gland it is converted to UDP-galactose which is then converted to lactose. The eukaryotic enzyme has no significant sequence similarity to the prokaryotic enzyme. Two transcript variants encoding different isoforms have been found for this gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 56.8 kDa |
AA Sequence : | MSRFVQDLSKAMSQDGASQFQEVIRQELELSVKKELEKILTTASSHEFEHTKKDLDGFRKLFHRFLQEKG PSVDWGKIQRPPEDSIQPYEKIKARGLPDNISSVLNKLVVVKLNGGLGTSMGCKGPKSLIGVRNENTFLD LTVQQIEHLNKTYNTDVPLVLMNSFNTDEDTKKILQKYNHCRVKIYTFNQSRYPRINKESLLPVAKDVSY SGENTEAWYPPGHGDIYASFYNSGLLDTFIGEGKEYIFVSNIDNLGATVDLYILNHLMNPPNGKRCEFVM EVTNKTRADVKGGTLTQYEGKLRLVEIAQVPKAHVDEFKSVSKFKIFNTNNLWISLAAVKRLQEQNAIDM EIIVNAKTLDGGLNVIQLETAVGAAIKSFENSLGINVPRSRFLPVKTTSDLLLVMSNLYSLNAGSLTMSE KREFPTVPLVKLGSSFTKVQDYLRRFESIPDMLELDHLTVSGDVTFGKNVSLKGTVIIIANHGDRIDIPP GAVLENKIVSGNLRILDHTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Protein Pathways : | Amino sugar and nucleotide sugar metabolism, Galactose metabolism, Metabolic pathways, Pentose and glucuronate interconversions, Starch and sucrose metabolism |
Full Length : | Full L. |
Gene Name | UGP2 UDP-glucose pyrophosphorylase 2 [ Homo sapiens (human) ] |
Official Symbol | UGP2 |
Synonyms | UDPG; UGP1; DEE83; UDPGP; UGPP1; UGPP2; EIEE83; SVUGP2; UDPGP2; pHC379 |
Gene ID | 7360 |
mRNA Refseq | NM_006759.4 |
Protein Refseq | NP_006750.3 |
MIM | 191760 |
UniProt ID | Q16851 |
◆ Recombinant Proteins | ||
UGP2-31662TH | Recombinant Human UGP2 | +Inquiry |
Ugp2-6828M | Recombinant Mouse Ugp2 Protein, Myc/DDK-tagged | +Inquiry |
UGP2-3585H | Recombinant Human UGP2, GST-tagged | +Inquiry |
UGP2-4911R | Recombinant Rhesus Macaque UGP2 Protein, His (Fc)-Avi-tagged | +Inquiry |
UGP2-642H | Recombinant Human UDP-glucose pyrophosphorylase 2, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
UGP2-514HCL | Recombinant Human UGP2 293 Cell Lysate | +Inquiry |
UGP2-515HCL | Recombinant Human UGP2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All UGP2 Products
Required fields are marked with *
My Review for All UGP2 Products
Required fields are marked with *
0
Inquiry Basket