Recombinant Full Length Human UGT1A10 Protein, C-Flag-tagged
| Cat.No. : | UGT1A10-1394HFL |
| Product Overview : | Recombinant Full Length Human UGT1A10 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Mammalian Cells |
| Tag : | Flag |
| Description : | This gene encodes a UDP-glucuronosyltransferase, an enzyme of the glucuronidation pathway that transforms small lipophilic molecules, such as steroids, bilirubin, hormones, and drugs, into water-soluble, excretable metabolites. This gene is part of a complex locus that encodes several UDP-glucuronosyltransferases. The locus includes thirteen unique alternate first exons followed by four common exons. Four of the alternate first exons are considered pseudogenes. Each of the remaining nine 5' exons may be spliced to the four common exons, resulting in nine proteins with different N-termini and identical C-termini. Each first exon encodes the substrate binding site, and is regulated by its own promoter. The enzyme encoded by this gene has glucuronidase activity on mycophenolic acid, coumarins, and quinolines. |
| Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
| Molecular Mass : | 57.2 kDa |
| AA Sequence : | MARAGWTSPVPLCVCLLLTCGFAEAGKLLVVPMDGSHWFTMQSVVEKLILRGHEVVVVMPEVSWQLERSL NCTVKTYSTSYTLEDQNREFMVFAHAQWKAQAQSIFSLLMSSSSGFLDLFFSHCRSLFNDRKLVEYLKES SFDAVFLDPFDTCGLIVAKYFSLPSVVFTRGIFCHHLEEGAQCPAPLSYVPNDLLGFSDAMTFKERVWNH IVHLEDHLFCQYLFRNALEIASEILQTPVTAYDLYSHTSIWLLRTDFVLDYPKPVMPNMIFIGGINCHQG KPLPMEFEAYINASGEHGIVVFSLGSMVSEIPEKKAMAIADALGKIPQTVLWRYTGTRPSNLANNTILVK WLPQNDLLGHPMTRAFITHAGSHGVYESICNGVPMVMMPLFGDQMDNAKRMETKGAGVTLNVLEMTSEDL ENALKAVINDKSYKENIMRLSSLHKDRPVEPLDLAVFWVEFVMRHKGAPHLRPAAHDLTWYQYHSLDVIG FLLAVVLTVAFITFKCCAYGYRKCLGKKGRVKKAHKSKTHTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
| Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Storage : | Store at -80 centigrade. |
| Concentration : | >50 ug/mL as determined by microplate BCA method. |
| Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Protein Families : | Transmembrane |
| Protein Pathways : | Androgen and estrogen metabolism, Ascorbate and aldarate metabolism, Drug metabolism - cytochrome P450, Drug metabolism - other enzymes, Metabolic pathways, Metabolism of xenobiotics by cytochrome P450, Pentose and glucuronate interconversions, Porphyrin and chlorophyll metabolism, Retinol metabolism, Starch and sucrose metabolism |
| Full Length : | Full L. |
| Gene Name | UGT1A10 UDP glucuronosyltransferase family 1 member A10 [ Homo sapiens (human) ] |
| Official Symbol | UGT1A10 |
| Synonyms | GNT1; UGT1; UDPGT; UGT1A; UGT1J; UGT-1A; UGT-1J; UGT1.1; UGT1A1; UGT1-01; UGT1-10; UGT1.10; hUG-BR1 |
| Gene ID | 54575 |
| mRNA Refseq | NM_019075.4 |
| Protein Refseq | NP_061948.1 |
| MIM | 606435 |
| UniProt ID | Q9HAW8 |
| ◆ Recombinant Proteins | ||
| UGT1A10-6359H | Recombinant Human UGT1A10 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| UGT1A10-2309H | Recombinant Human UGT1A10 Protein, His (Fc)-Avi-tagged | +Inquiry |
| UGT1A10-101H | Active Recombinant Human UGT1A10 Protein | +Inquiry |
| UGT1A10-1394HFL | Recombinant Full Length Human UGT1A10 Protein, C-Flag-tagged | +Inquiry |
| UGT1A10-513H | Recombinant Human UGT1A10 Protein, MYC/DDK-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All UGT1A10 Products
Required fields are marked with *
My Review for All UGT1A10 Products
Required fields are marked with *




