Recombinant Full Length Human Uncharacterized Membrane Protein C19Orf24(C19Orf24) Protein, His-Tagged
Cat.No. : | RFL28280HF |
Product Overview : | Recombinant Full Length Human Uncharacterized membrane protein C19orf24(C19orf24) Protein (Q9BVV8) (27-132aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (27-132) |
Form : | Lyophilized powder |
AA Sequence : | EEASPLRPAQVTLSPPPAVTNGSQPGAPHNSTHTRPPGASGSALTRSFYVILGFCGLTAL YFLIRAFRLKKPQRRRYGLLANTEDPTEMASLDSDEETVFESRNLR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | C19orf24 |
Synonyms | FAM174C; C19orf24; Protein FAM174C |
UniProt ID | Q9BVV8 |
◆ Recombinant Proteins | ||
RFL28280HF | Recombinant Full Length Human Uncharacterized Membrane Protein C19Orf24(C19Orf24) Protein, His-Tagged | +Inquiry |
C19orf24-10432H | Recombinant Human C19orf24, GST-tagged | +Inquiry |
C19orf24-2586H | Recombinant Human C19orf24 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
C19orf24-8213HCL | Recombinant Human C19orf24 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All C19orf24 Products
Required fields are marked with *
My Review for All C19orf24 Products
Required fields are marked with *