Recombinant Human C19orf24 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : C19orf24-2586H
Product Overview : C19orf24 MS Standard C13 and N15-labeled recombinant protein (NP_060384) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : FAM174C (Family With Sequence Similarity 174 Member C) is a Protein Coding gene.
Molecular Mass : 14.1 kDa
AA Sequence : MREGQEMGPTPVPSNPLLHRSFPCWPRGWSHPVPTRELLLEPAQPADLLPPAPTAGPCSLASWMLSQPGRGSQVKTGGTPTATAQDAEAPLPDCDLCLSPAPVGTWQPRAKAGWAGDPRNLSGNTFSPGWEQTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name C19orf24 chromosome 19 open reading frame 24 [ Homo sapiens (human) ]
Official Symbol C19orf24
Synonyms C19ORF24; chromosome 19 open reading frame 24; uncharacterized membrane protein C19orf24; FLJ20640;
Gene ID 55009
mRNA Refseq NM_017914
Protein Refseq NP_060384
UniProt ID Q9BVV8

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All C19orf24 Products

Required fields are marked with *

My Review for All C19orf24 Products

Required fields are marked with *

0
cart-icon