Recombinant Human C19orf24 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | C19orf24-2586H |
| Product Overview : | C19orf24 MS Standard C13 and N15-labeled recombinant protein (NP_060384) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | FAM174C (Family With Sequence Similarity 174 Member C) is a Protein Coding gene. |
| Molecular Mass : | 14.1 kDa |
| AA Sequence : | MREGQEMGPTPVPSNPLLHRSFPCWPRGWSHPVPTRELLLEPAQPADLLPPAPTAGPCSLASWMLSQPGRGSQVKTGGTPTATAQDAEAPLPDCDLCLSPAPVGTWQPRAKAGWAGDPRNLSGNTFSPGWEQTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | C19orf24 chromosome 19 open reading frame 24 [ Homo sapiens (human) ] |
| Official Symbol | C19orf24 |
| Synonyms | C19ORF24; chromosome 19 open reading frame 24; uncharacterized membrane protein C19orf24; FLJ20640; |
| Gene ID | 55009 |
| mRNA Refseq | NM_017914 |
| Protein Refseq | NP_060384 |
| UniProt ID | Q9BVV8 |
| ◆ Recombinant Proteins | ||
| C19orf24-2586H | Recombinant Human C19orf24 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| RFL28280HF | Recombinant Full Length Human Uncharacterized Membrane Protein C19Orf24(C19Orf24) Protein, His-Tagged | +Inquiry |
| C19orf24-10432H | Recombinant Human C19orf24, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| C19orf24-8213HCL | Recombinant Human C19orf24 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All C19orf24 Products
Required fields are marked with *
My Review for All C19orf24 Products
Required fields are marked with *
