Recombinant Human C19orf24 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: C19orf24-2586H
• Product Overview: C19orf24 MS Standard C13 and N15-labeled recombinant protein (NP_060384) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: FAM174C (Family With Sequence Similarity 174 Member C) is a Protein Coding gene.
• Molecular Mass: 14.1 kDa
• AA Sequence: MREGQEMGPTPVPSNPLLHRSFPCWPRGWSHPVPTRELLLEPAQPADLLPPAPTAGPCSLASWMLSQPGRGSQVKTGGTPTATAQDAEAPLPDCDLCLSPAPVGTWQPRAKAGWAGDPRNLSGNTFSPGWEQTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: C19orf24 chromosome 19 open reading frame 24 [ Homo sapiens (human) ]
• Official Symbol: C19orf24
• Synonyms: C19ORF24; chromosome 19 open reading frame 24; uncharacterized membrane protein C19orf24; FLJ20640
• Gene ID: 55009
• mRNA Refseq: NM_017914
• Protein Refseq: NP_060384
• UniProt ID: Q9BVV8