Recombinant Full Length Human UQCRB Protein, Flag tagged

• Cat.No.: UQCRB-15HFL
• Product Overview: Recombinant protein of human ubiquinol-cytochrome c reductase binding protein (UQCRB), nuclear gene encoding mitochondrial protein with Flag tag was expressed in HEK293T.

Specification

• Species: Human
• Source: HEK293T
• Tag: Flag
• Protein Length: 1-111 aa
• Description: This gene encodes a subunit of the ubiquinol-cytochrome c oxidoreductase complex, which consists of one mitochondrial-encoded and 10 nuclear-encoded subunits. The protein encoded by this gene binds ubiquinone and participates in the transfer of electrons when ubiquinone is bound. This protein plays an important role in hypoxia-induced angiogenesis through mitochondrial reactive oxygen species-mediated signaling. Mutations in this gene are associated with mitochondrial complex III deficiency. Alternatively spliced transcript variants have been found for this gene. Related pseudogenes have been identified on chromosomes 1, 5 and X.
• Form: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Molecular Mass: 13.3 kDa
• AASequence: MAGKQAVSASGKWLDGIRKWYYNAAGFNKLGLMRDDTIYEDEDVKEAIRRLPENLYNDRMFRIKRALDLNLKHQILPKEQWTKYEEENFYLEPYLKEVIRERKEREEWAKKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Notes: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80 centigrade. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Concentration: > 0.05 μg/μL as determined by microplate BCA method

Gene Information

• Gene Name: UQCRB ubiquinol-cytochrome c reductase binding protein [ Homo sapiens (human) ]
• Official Symbol: UQCRB
• Synonyms: UQCRB; ubiquinol-cytochrome c reductase binding protein; QPC; QCR7; QP-C; UQBC; UQBP; UQPC; UQCR6; MC3DN3; cytochrome b-c1 complex subunit 7; complex III subunit 7; complex III subunit VII; mitochondrial ubiquinone-binding protein; ubiquinol-cytochrome c reductase complex 14 kDa protein; ubiquinol-cytochrome c reductase, complex III subunit VI; EC 7.1.1.8
• Gene ID: 7381
• mRNA Refseq: NM_006294
• Protein Refseq: NP_006285
• MIM: 191330
• UniProt ID: P14927