Recombinant Full Length Human VIT Protein, GST-tagged

Cat.No. : VIT-1802HF
Product Overview : Recombinant Human VIT(1 a.a. - 203 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 203 amino acids
Description : This gene encodes an extracellular matrix (ECM) protein. The protein may be associated with cell adhesion and migration. High levels of expression of the protein in specific parts of the brain suggest its likely role in neural development.
Form : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 48.2 kDa
AA Sequence : MRTVVLTMKASVIEMFLVLLVTGVHSNKETAKKIKRPKFTVPQINCDVKAGKIIDPEFIVKCPAGCQDPKYHVYGTDVYASYSSVCGAAVHSGVLDNSGGKILVRKVAGQSGYKGSYSNGVQSLSLPRWRESFIVLESKPKKGVTYPSALTYSSSKSPAAQAGKCSRVIESKPSESMNTRRVLGDSGEINILTGQAPLALAIF
Applications : Enzyme-linked Immunoabsorbent; Assay Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name VIT vitrin [ Homo sapiens ]
Official Symbol VIT
Synonyms VIT; vitrin; MGC70561; MGC149746; DKFZp313L1517
Gene ID 5212
mRNA Refseq NM_001177969
Protein Refseq NP_001171440
MIM 617693
UniProt ID Q6UXI7

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All VIT Products

Required fields are marked with *

My Review for All VIT Products

Required fields are marked with *

0
cart-icon