"VIT" Related Products

Expand

Recombinant Human VIT Protein, GST-tagged

Cat.No.: VIT-30H
Product Overview: Recombinant Human VIT(1 a.a. - 203 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
Description: This gene encodes an extracellular matrix (ECM) protein. The protein may be associated with cell adhesion and migration. High levels of expression of the protein in specific parts of the brain suggest its likely role in neural development.
Source: Wheat Germ
Species: Human
Tag : GST
Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass: 48.2 kDa
Protein length: 1 a.a. - 203 a.a.
AA Sequence: MRTVVLTMKASVIEMFLVLLVTGVHSNKETAKKIKRPKFTVPQINCDVKAGKIIDPEFIVKCPAGCQDPKYHVYGTDVYASYSSVCGAAVHSGVLDNSGGKILVRKVAGQSGYKGSYSNGVQSLSLPRWRESFIVLESKPKKGVTYPSALTYSSSKSPAAQAGKCSRVIESKPSESMNTRRVLGDSGEINILTGQAPLALAIF
Applications: Enzyme-linked Immunoabsorbent; Assay Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes: Best use within three months from the date of receipt of this protein.
Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name: VIT vitrin [ Homo sapiens ]
Official Symbol: VIT
Synonyms: VIT; vitrin; MGC70561; MGC149746; DKFZp313L1517;
Gene ID: 5212
mRNA Refseq: NM_001177969
Protein Refseq: NP_001171440
UniProt ID: Q6UXI7

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.