Recombinant Human VIT Protein, GST-tagged
Cat.No. : | VIT-30H |
Product Overview : | Recombinant Human VIT(1 a.a. - 203 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 1 a.a. - 203 a.a. |
Description : | This gene encodes an extracellular matrix (ECM) protein. The protein may be associated with cell adhesion and migration. High levels of expression of the protein in specific parts of the brain suggest its likely role in neural development. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 48.2 kDa |
AA Sequence : | MRTVVLTMKASVIEMFLVLLVTGVHSNKETAKKIKRPKFTVPQINCDVKAGKIIDPEFIVKCPAGCQDPKYHVYGTDVYASYSSVCGAAVHSGVLDNSGGKILVRKVAGQSGYKGSYSNGVQSLSLPRWRESFIVLESKPKKGVTYPSALTYSSSKSPAAQAGKCSRVIESKPSESMNTRRVLGDSGEINILTGQAPLALAIF |
Applications : | Enzyme-linked Immunoabsorbent; Assay Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | VIT vitrin [ Homo sapiens ] |
Official Symbol | VIT |
Synonyms | VIT; vitrin; MGC70561; MGC149746; DKFZp313L1517; |
Gene ID | 5212 |
mRNA Refseq | NM_001177969 |
Protein Refseq | NP_001171440 |
UniProt ID | Q6UXI7 |
◆ Recombinant Proteins | ||
VIT-10022M | Recombinant Mouse VIT Protein, His (Fc)-Avi-tagged | +Inquiry |
VIT-2185C | Recombinant Chicken VIT | +Inquiry |
VIT-30H | Recombinant Human VIT Protein, GST-tagged | +Inquiry |
VIT-1802HF | Recombinant Full Length Human VIT Protein, GST-tagged | +Inquiry |
VIT-18023M | Recombinant Mouse VIT Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
VIT-406HCL | Recombinant Human VIT 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All VIT Products
Required fields are marked with *
My Review for All VIT Products
Required fields are marked with *
0
Inquiry Basket