Recombinant Full Length Human VPS26A Protein, C-Flag-tagged
Cat.No. : | VPS26A-2190HFL |
Product Overview : | Recombinant Full Length Human VPS26A Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene belongs to a group of vacuolar protein sorting (VPS) genes. The encoded protein is a component of a large multimeric complex, termed the retromer complex, involved in retrograde transport of proteins from endosomes to the trans-Golgi network. The close structural similarity between the yeast and human proteins that make up this complex suggests a similarity in function. Expression studies in yeast and mammalian cells indicate that this protein interacts directly with VPS35, which serves as the core of the retromer complex. Alternative splicing results in multiple transcript variants encoding different isoforms. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 38 kDa |
AA Sequence : | MSFLGGFFGPICEIDIVLNDGETRKMAEMKTEDGKVEKHYLFYDGESVSGKVNLAFKQPGKRLEHQGIRI EFVGQIELFNDKSNTHEFVNLVKELALPGELTQSRSYDFEFMQVEKPYESYIGANVRLRYFLKVTIVRRL TDLVKEYDLIVHQLATYPDVNNSIKMEVGIEDCLHIEFEYNKSKYHLKDVIVGKIYFLLVRIKIQHMELQ LIKKEITGIGPSTTTETETIAKYEIMDGAPVKGESIPIRLFLAGYDPTPTMRDVNKKFSVRYFLNLVLVD EEDRRYFKQQEIILWRKAPEKLRKQRTNFHQRFESPESQASAEQPEM myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | VPS26A VPS26 retromer complex component A [ Homo sapiens (human) ] |
Official Symbol | VPS26A |
Synonyms | HB58; PEP8A; VPS26; Hbeta58 |
Gene ID | 9559 |
mRNA Refseq | NM_004896.5 |
Protein Refseq | NP_004887.2 |
MIM | 605506 |
UniProt ID | O75436 |
◆ Recombinant Proteins | ||
VPS26A-3673H | Recombinant Human VPS26A, His-tagged | +Inquiry |
VPS26A-2342H | Recombinant Human VPS26A Protein, His (Fc)-Avi-tagged | +Inquiry |
VPS26A-6197R | Recombinant Rat VPS26A Protein, His (Fc)-Avi-tagged | +Inquiry |
VPS26A-6954H | Recombinant Human Vacuolar Protein Sorting 26 Homolog A (S. pombe), His-tagged | +Inquiry |
Vps26a-6932M | Recombinant Mouse Vps26a Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
VPS26A-394HCL | Recombinant Human VPS26A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All VPS26A Products
Required fields are marked with *
My Review for All VPS26A Products
Required fields are marked with *
0
Inquiry Basket