Recombinant Full Length Human YTHDF1 Protein, C-Flag-tagged
Cat.No. : | YTHDF1-1236HFL |
Product Overview : | Recombinant Full Length Human YTHDF1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Enables N6-methyladenosine-containing RNA binding activity and ribosome binding activity. Involved in mRNA destabilization; positive regulation of translational initiation; and stress granule assembly. Located in P-body and cytoplasmic stress granule. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 60.7 kDa |
AA Sequence : | MSATSVDTQRTKGQDNKVQNGSLHQKDTVHDNDFEPYLTGQSNQSNSYPSMSDPYLSSYYPPSIGFPYSL NEAPWSTAGDPPIPYLTTYGQLSNGDHHFMHDAVFGQPGGLGNNIYQHRFNFFPENPAFSAWGTSGSQGQ QTQSSAYGSSYTYPPSSLGGTVVDGQPGFHSDTLSKAPGMNSLEQGMVGLKIGDVSSSAVKTVGSVVSSV ALTGVLSGNGGTNVNMPVSKPTSWAAIASKPAKPQPKMKTKSGPVMGGGLPPPPIKHNMDIGTWDNKGPV PKAPVPQQAPSPQAAPQPQQVAQPLPAQPPALAQPQYQSPQQPPQTRWVAPRNRNAAFGQSGGAGSDSNS PGNVQPNSAPSVESHPVLEKLKAAHSYNPKEFEWNLKSGRVFIIKSYSEDDIHRSIKYSIWCSTEHGNKR LDSAFRCMSSKGPVYLLFSVNGSGHFCGVAEMKSPVDYGTSAGVWSQDKWKGKFDVQWIFVKDVPNNQLR HIRLENNDNKPVTNSRDTQEVPLEKAKQVLKIISSYKHTTSIFDDFAHYEKRQEEEEVVRKERQSRNKQTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | YTHDF1 YTH N6-methyladenosine RNA binding protein 1 [ Homo sapiens (human) ] |
Official Symbol | YTHDF1 |
Synonyms | DF1; C20orf21 |
Gene ID | 54915 |
mRNA Refseq | NM_017798.4 |
Protein Refseq | NP_060268.2 |
MIM | 616529 |
UniProt ID | Q9BYJ9 |
◆ Recombinant Proteins | ||
YTHDF1-979H | Recombinant Human YTHDF1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
YTHDF1-5057R | Recombinant Rhesus Macaque YTHDF1 Protein, His (Fc)-Avi-tagged | +Inquiry |
YTHDF1-11987Z | Recombinant Zebrafish YTHDF1 | +Inquiry |
YTHDF1-7855H | Recombinant Human YTHDF1 protein, His-tagged | +Inquiry |
YTHDF1-2478H | Recombinant Human YTHDF1 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
YTHDF1-237HCL | Recombinant Human YTHDF1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All YTHDF1 Products
Required fields are marked with *
My Review for All YTHDF1 Products
Required fields are marked with *
0
Inquiry Basket