Recombinant Full Length Human Zinc Transporter Zip14(Slc39A14) Protein, His-Tagged
Cat.No. : | RFL2265HF |
Product Overview : | Recombinant Full Length Human Zinc transporter ZIP14(SLC39A14) Protein (Q15043) (31-492aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (31-492) |
Form : | Lyophilized powder |
AA Sequence : | SSLGAPAISAASFLQDLIHRYGEGDSLTLQQLKALLNHLDVGVGRGNVTQHVQGHRNLST CFSSGDLFTAHNFSEQSRIGSSELQEFCPTILQQLDSRACTSENQENEENEQTEEGRPSA VEVWGYGLLCVTVISLCSLLGASVVPFMKKTFYKRLLLYFIALAIGTLYSNALFQLIPEA FGFNPLEDYYVSKSAVVFGGFYLFFFTEKILKILLKQKNEHHHGHSHYASESLPSKKDQE EGVMEKLQNGDLDHMIPQHCSSELDGKAPMVDEKVIVGSLSVQDLQASQSACYWLKGVRY SDIGTLAWMITLSDGLHNFIDGLAIGASFTVSVFQGISTSVAILCEEFPHELGDFVILLN AGMSIQQALFFNFLSACCCYLGLAFGILAGSHFSANWIFALAGGMFLYISLADMFPEMNE VCQEDERKGSILIPFIIQNLGLLTGFTIMVVLTMYSGQIQIG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | SLC39A14 |
Synonyms | SLC39A14; KIAA0062; ZIP14; Metal cation symporter ZIP14; LIV-1 subfamily of ZIP zinc transporter 4; LZT-Hs4; Solute carrier family 39 member 14; Zrt- and Irt-like protein 14; ZIP-14 |
UniProt ID | Q15043 |
◆ Recombinant Proteins | ||
RFL2265HF | Recombinant Full Length Human Zinc Transporter Zip14(Slc39A14) Protein, His-Tagged | +Inquiry |
SLC39A14-15434M | Recombinant Mouse SLC39A14 Protein | +Inquiry |
RFL18086BF | Recombinant Full Length Bovine Zinc Transporter Zip14(Slc39A14) Protein, His-Tagged | +Inquiry |
RFL27615XF | Recombinant Full Length Xenopus Tropicalis Zinc Transporter Zip14(Slc39A14) Protein, His-Tagged | +Inquiry |
SLC39A14-6827HF | Recombinant Full Length Human SLC39A14 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SLC39A14 Products
Required fields are marked with *
My Review for All SLC39A14 Products
Required fields are marked with *
0
Inquiry Basket