Recombinant Human SLC39A14 protein, GST-tagged

Cat.No. : SLC39A14-3655H
Product Overview : Recombinant Human SLC39A14 protein(34-152 aa), fused to GST tag, was expressed in E. coli.
Availability May 21, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 34-152 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH.
AA Sequence : GAPAISAASFLQDLIHRYGEGDSLTLQQLKALLNHLDVGVGRGNVTQHVQGHRNLSTCFSSGDLFTAHNFSEQSRIGSSELQEFCPTILQQLDSRACTSENQENEENEQTEEGRPSAVE
Purity : 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name SLC39A14 solute carrier family 39 (zinc transporter), member 14 [ Homo sapiens ]
Official Symbol SLC39A14
Synonyms SLC39A14; solute carrier family 39 (zinc transporter), member 14; solute carrier family 39 (metal ion transporter), member 14; zinc transporter ZIP14; KIAA0062; NET34; ZIP14; ZIP-14; Zrt-, Irt-like protein 14; zrt- and Irt-like protein 14; solute carrier family 39 member 14; LIV-1 subfamily of ZIP zinc transporter 4; cig19; LZT-Hs4;
Gene ID 23516
mRNA Refseq NM_001128431
Protein Refseq NP_001121903
MIM 608736
UniProt ID Q15043

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All SLC39A14 Products

Required fields are marked with *

My Review for All SLC39A14 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon