Recombinant Human SLC39A14 protein, GST-tagged
Cat.No. : | SLC39A14-3655H |
Product Overview : | Recombinant Human SLC39A14 protein(34-152 aa), fused to GST tag, was expressed in E. coli. |
Availability | August 08, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 34-152 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
AA Sequence : | GAPAISAASFLQDLIHRYGEGDSLTLQQLKALLNHLDVGVGRGNVTQHVQGHRNLSTCFSSGDLFTAHNFSEQSRIGSSELQEFCPTILQQLDSRACTSENQENEENEQTEEGRPSAVE |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | SLC39A14 solute carrier family 39 (zinc transporter), member 14 [ Homo sapiens ] |
Official Symbol | SLC39A14 |
Synonyms | SLC39A14; solute carrier family 39 (zinc transporter), member 14; solute carrier family 39 (metal ion transporter), member 14; zinc transporter ZIP14; KIAA0062; NET34; ZIP14; ZIP-14; Zrt-, Irt-like protein 14; zrt- and Irt-like protein 14; solute carrier family 39 member 14; LIV-1 subfamily of ZIP zinc transporter 4; cig19; LZT-Hs4; |
Gene ID | 23516 |
mRNA Refseq | NM_001128431 |
Protein Refseq | NP_001121903 |
MIM | 608736 |
UniProt ID | Q15043 |
◆ Recombinant Proteins | ||
SLC39A14-681H | Recombinant Human SLC39A14 Protein | +Inquiry |
SLC39A14-6827HF | Recombinant Full Length Human SLC39A14 Protein | +Inquiry |
RFL2265HF | Recombinant Full Length Human Zinc Transporter Zip14(Slc39A14) Protein, His-Tagged | +Inquiry |
SLC39A14-4564H | Recombinant Human SLC39A14 protein, His-tagged | +Inquiry |
RFL18086BF | Recombinant Full Length Bovine Zinc Transporter Zip14(Slc39A14) Protein, His-Tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SLC39A14 Products
Required fields are marked with *
My Review for All SLC39A14 Products
Required fields are marked with *