Recombinant Full Length Influenza A virus (strain A/Puerto Rico/8/1934 H1N1) Matrix protein 1, His tagged

Cat.No. : M1-4376I
Product Overview : Recombinant Full Length Influenza A virus (strain A/Puerto Rico/8/1934 H1N1) Matrix protein 1 with His tag was expressed in CHO.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Influenza A virus
Source : CHO
Tag : His
Protein Length : 1-252 aa
Molecular Mass : 30 kDa
AA Sequence : HHHHHHHHHHDDDDKMSLLTEVETYVLSIIPSGPLKAEIAQRLEDVFAGKNTDLEVLMEWLKTRPILSPLTKGILGFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDKAVKLYRKLKREITFHGAKEISLSYSAGALASCMGLIYNRMGAVTTEVAFGLVCATCEQIADSQHRSHRQMVTTTNPLIRHENRMVLASTTAKAMEQMAGSSEQAAEAMEVASQARQMVQAMRTIGTHPSSSAGLKNDLLENLQAYQKRMGVQMQRFK
Purity : > 90 % by SDS-PAGE
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Storage Buffer : Sterile PBS, pH7.4, 5 % Glycerol
Concentration : 0.12 mg/mL by BCA
Official Symbol M1
Synonyms M1; Matrix protein 1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All M1 Products

Required fields are marked with *

My Review for All M1 Products

Required fields are marked with *

0
cart-icon