Recombinant Full Length Influenza A virus (strain A/Puerto Rico/8/1934 H1N1) Matrix protein 1, His tagged
Cat.No. : | M1-4376I |
Product Overview : | Recombinant Full Length Influenza A virus (strain A/Puerto Rico/8/1934 H1N1) Matrix protein 1 with His tag was expressed in CHO. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Influenza A virus |
Source : | CHO |
Tag : | His |
Protein Length : | 1-252 aa |
Molecular Mass : | 30 kDa |
AA Sequence : | HHHHHHHHHHDDDDKMSLLTEVETYVLSIIPSGPLKAEIAQRLEDVFAGKNTDLEVLMEWLKTRPILSPLTKGILGFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDKAVKLYRKLKREITFHGAKEISLSYSAGALASCMGLIYNRMGAVTTEVAFGLVCATCEQIADSQHRSHRQMVTTTNPLIRHENRMVLASTTAKAMEQMAGSSEQAAEAMEVASQARQMVQAMRTIGTHPSSSAGLKNDLLENLQAYQKRMGVQMQRFK |
Purity : | > 90 % by SDS-PAGE |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Sterile PBS, pH7.4, 5 % Glycerol |
Concentration : | 0.12 mg/mL by BCA |
Official Symbol | M1 |
Synonyms | M1; Matrix protein 1 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All M1 Products
Required fields are marked with *
My Review for All M1 Products
Required fields are marked with *