Recombinant Full Length Influenza A virus (strain A/Puerto Rico/8/1934 H1N1) Matrix protein 1, His tagged

• Cat.No.: M1-4376I
• Product Overview: Recombinant Full Length Influenza A virus (strain A/Puerto Rico/8/1934 H1N1) Matrix protein 1 with His tag was expressed in CHO.

Specification

• Species: Influenza A virus
• Source: CHO
• Tag: His
• Protein Length: 1-252 aa
• Molecular Mass: 30 kDa
• AA Sequence: HHHHHHHHHHDDDDKMSLLTEVETYVLSIIPSGPLKAEIAQRLEDVFAGKNTDLEVLMEWLKTRPILSPLTKGILGFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDKAVKLYRKLKREITFHGAKEISLSYSAGALASCMGLIYNRMGAVTTEVAFGLVCATCEQIADSQHRSHRQMVTTTNPLIRHENRMVLASTTAKAMEQMAGSSEQAAEAMEVASQARQMVQAMRTIGTHPSSSAGLKNDLLENLQAYQKRMGVQMQRFK
• Purity: > 90 % by SDS-PAGE
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Storage Buffer: Sterile PBS, pH7.4, 5 % Glycerol
• Concentration: 0.12 mg/mL by BCA

Gene Information

• Official Symbol: M1
• Synonyms: M1; Matrix protein 1