Recombinant Full Length Macaca Fascicularis Pra1 Family Protein 3(Arl6Ip5) Protein, His-Tagged
Cat.No. : | RFL16052MF |
Product Overview : | Recombinant Full Length Macaca fascicularis PRA1 family protein 3(ARL6IP5) Protein (Q4R4R4) (1-188aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Macaca fascicularis |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-188) |
Form : | Lyophilized powder |
AA Sequence : | MDVNIAPLRAWDDFFPGSDRFAQPDFRDISKWNNRVVSNLLYYQTNYLVVAAMMISVVGF LSPFNMILGGIVVVLVFTGFVWAAHNKDALRRLKKRYPTTFVMVVMLASYFLISMFGGVM VFVFGITFPLLLMFIHASLRLRNLKNKLENKMEGIGLKRTPMGIVLDALEQQEEGINRLT DYISKVKE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ARL6IP5 |
Synonyms | ARL6IP5; PRAF3; QnpA-10140; PRA1 family protein 3; ADP-ribosylation factor-like protein 6-interacting protein 5; ARL-6-interacting protein 5; Aip-5 |
UniProt ID | Q4R4R4 |
◆ Recombinant Proteins | ||
RFL26750GF | Recombinant Full Length Chicken Pra1 Family Protein 3(Arl6Ip5) Protein, His-Tagged | +Inquiry |
ARL6IP5-786R | Recombinant Rat ARL6IP5 Protein | +Inquiry |
ARL6IP5-442R | Recombinant Rat ARL6IP5 Protein, His (Fc)-Avi-tagged | +Inquiry |
ARL6IP5-9863H | Recombinant Human ARL6IP5 protein, GST-tagged | +Inquiry |
ARL6IP5-62C | Recombinant Cynomolgus Monkey ARL6IP5 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ARL6IP5-36HCL | Recombinant Human ARL6IP5 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ARL6IP5 Products
Required fields are marked with *
My Review for All ARL6IP5 Products
Required fields are marked with *
0
Inquiry Basket