Recombinant Full Length Macaca Fascicularis Uncharacterized Protein C7Orf45 Homolog(Qtsa-20413) Protein, His-Tagged
Cat.No. : | RFL1771MF |
Product Overview : | Recombinant Full Length Macaca fascicularis Uncharacterized protein C7orf45 homolog(QtsA-20413) Protein (Q4R309) (1-244aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Macaca fascicularis |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-244) |
Form : | Lyophilized powder |
AA Sequence : | MGDLFSLFWEVDPPPIPLNCAIPNQDYECRKDDSCGTIGNFLLWYFVIVFVLMFFSRASV WMSEDKKDEGSGTSTSVRKASKETSYKWQSKDGAWDPSQTMKKPKQNQLTPVTNSEVALV NAYLEQRRARRQSQFNEVNQNQHDSDTTECGSEESNSEASSWKESESEHHPSPDSIKRRK MAQRQRNLGSYQMSERHCLHCKAMRTNEWLVHHSQQKASVTPPMKGDSPEESSISDINTK FSKF |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | SSMEM1 |
Synonyms | SSMEM1; QtsA-20413; Serine-rich single-pass membrane protein 1 |
UniProt ID | Q4R309 |
◆ Recombinant Proteins | ||
SSMEM1-979C | Recombinant Cynomolgus SSMEM1 Protein, His-tagged | +Inquiry |
RFL31812HF | Recombinant Full Length Human Uncharacterized Protein C7Orf45(C7Orf45) Protein, His-Tagged | +Inquiry |
SSMEM1-722C | Recombinant Cynomolgus Monkey SSMEM1 Protein, His (Fc)-Avi-tagged | +Inquiry |
SSMEM1 -0146H | Recombinant Human SSMEM1 Protein, GST-Tagged | +Inquiry |
SSMEM1-2626HF | Recombinant Full Length Human SSMEM1 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SSMEM1 Products
Required fields are marked with *
My Review for All SSMEM1 Products
Required fields are marked with *