Recombinant Full Length Macaca Mulatta Elongation Of Very Long Chain Fatty Acids Protein 4(Elovl4) Protein, His-Tagged
Cat.No. : | RFL21207MF |
Product Overview : | Recombinant Full Length Macaca mulatta Elongation of very long chain fatty acids protein 4(ELOVL4) Protein (Q3S8M4) (1-314aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Macaca mulatta |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-314) |
Form : | Lyophilized powder |
AA Sequence : | MGLLDSEPGSVLNVVSTALNDTVEFYRWTWSIADKRVENWPLMQSPWPTLSISTLYLLFV WLGPKWMKDREPFQMRLVLIIYNFGMVLLNFFIFRELFMGSYNAGYSYICQSVDYSNNVN EVRIAAALWWYFVSKGVEYLDTVFFILRKKNNQVSFLHVYHHCTMFTLWWIGIKWVAGGQ AFFGAQMNSFIHVIMYSYYGLAAFGPWIQKYLWWKRYLTMLQLVQFHVTIGHTALSLYTD CPFPKWMHWALIAYAISFIFLFLNFYIRTYKEPKKPKTGKTAMNGISANGVSKSEKQLVI ENGKKQKNGKAKGD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ELOVL4 |
Synonyms | ELOVL4; Elongation of very long chain fatty acids protein 4; 3-keto acyl-CoA synthase ELOVL4; ELOVL fatty acid elongase 4; ELOVL FA elongase 4; Very long chain 3-ketoacyl-CoA synthase 4; Very long chain 3-oxoacyl-CoA synthase 4 |
UniProt ID | Q3S8M4 |
◆ Recombinant Proteins | ||
ELOVL4-3262H | Recombinant Human ELOVL4 Protein, GST-tagged | +Inquiry |
ELOVL4-5150M | Recombinant Mouse ELOVL4 Protein | +Inquiry |
ELOVL4-4173C | Recombinant Chicken ELOVL4 | +Inquiry |
ELOVL4-1277R | Recombinant Rhesus Macaque ELOVL4 Protein, His (Fc)-Avi-tagged | +Inquiry |
ELOVL4-2752M | Recombinant Mouse ELOVL4 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ELOVL4 Products
Required fields are marked with *
My Review for All ELOVL4 Products
Required fields are marked with *