Recombinant Full Length Macaca Mulatta (Rhesus Macaque) C-C Chemokine Receptor Type 2(Ccr2) Protein, His-Tagged
Cat.No. : | RFL28107MF |
Product Overview : | Recombinant Full Length Macaca mulatta (Rhesus macaque) C-C chemokine receptor type 2(CCR2) Protein (O18793) (1-360aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Macaca mulatta |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-360) |
Form : | Lyophilized powder |
AA Sequence : | MLSTSRSRFIRNTNGSGEEVTTFFDYDYGAPCHKFDVKQIGAQLLPPLYSLVFIFGFVGN MLVVLILINCKKLKSLTDIYLLNLAISDLLFLITLPLWAHSAANEWVFGNAMCKLFTGLY HIGYLGGIFFIILLTIDRYLAIVHAVFALKARTVTFGVVTSVITWLVAVFASVPGIIFTK CQEEDSVYICGPYFPRGWNNFHTIMRNILGLVLPLLIMVICYSGILKTLLRCRNEKKRHR AVRLIFTIMIVYFLFWTPYNIVILLNTFQEFFGLSNCESTRQLDQATQVTETLGMTHCCI NPIIYAFVGEKFRRYLSMFFRKYITKRFCKQCPVFYRETVDGVTSTNTPSTAEQEVSVGL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | CCR2 |
Synonyms | CCR2; CMKBR2; C-C chemokine receptor type 2; C-C CKR-2; CC-CKR-2; CCR-2; CCR2; Monocyte chemoattractant protein 1 receptor; MCP-1-R; CD antigen CD192 |
UniProt ID | O18793 |
◆ Recombinant Proteins | ||
RFL4539MF | Recombinant Full Length Mouse C-C Chemokine Receptor Type 2(Ccr2) Protein, His-Tagged | +Inquiry |
CCR2-1072HFL | Recombinant Human CCR2 protein, His&Flag-tagged | +Inquiry |
CCR2-3494C | Recombinant Chicken CCR2 | +Inquiry |
RFL10533HF | Recombinant Full Length Human C-C Chemokine Receptor Type 2(Ccr2) (Active) Protein, His-Tagged | +Inquiry |
CCR2-3015M | Recombinant Mouse CCR2 protein, hFc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCR2-7696HCL | Recombinant Human CCR2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CCR2 Products
Required fields are marked with *
My Review for All CCR2 Products
Required fields are marked with *
0
Inquiry Basket