Recombinant Human HSD3B2
| Cat.No. : | HSD3B2-29345TH | 
| Product Overview : | Recombinant fragment of Human HSD3B2 (aa 33-122) with N-terminal proprietary tag, 35.53 kDa. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | Wheat Germ | 
| Tag : | Non | 
| Protein Length : | 90 amino acids | 
| Description : | The protein encoded by this gene is a bifunctional enzyme that catalyzes the oxidative conversion of delta(5)-ene-3-beta-hydroxy steroid, and the oxidative conversion of ketosteroids. It plays a crucial role in the biosynthesis of all classes of hormonal steroids. This gene is predominantly expressed in the adrenals and the gonads. Mutations in this gene are associated with 3-beta-hydroxysteroid dehydrogenase, type II, deficiency. Alternatively spliced transcript variants have been found for this gene. | 
| Molecular Weight : | 35.530kDa inclusive of tags | 
| Tissue specificity : | Expressed in adrenal gland, testis and ovary. | 
| Form : | Liquid | 
| Purity : | Proprietary Purification | 
| Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl | 
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. | 
| Sequences of amino acids : | ALDKAFRPELREEFSKLQNRTKLTVLEGDILDEPFLKRACQDVSVVIHTACIIDVFGVTHRESIMNVNVKGTQLLLEACVQASVPVFIYT | 
| Sequence Similarities : | Belongs to the 3-beta-HSD family. | 
| Gene Name | HSD3B2 hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 2 [ Homo sapiens ] | 
| Official Symbol | HSD3B2 | 
| Synonyms | HSD3B2; hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 2; 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 2; SDR11E2; short chain dehydrogenase/reductase family 11E; member 2; | 
| Gene ID | 3284 | 
| mRNA Refseq | NM_000198 | 
| Protein Refseq | NP_000189 | 
| MIM | 613890 | 
| Uniprot ID | P26439 | 
| Chromosome Location | 1p12 | 
| Pathway | Androgen biosynthesis, organism-specific biosystem; C19/C18-Steroid hormone biosynthesis, pregnenolone => androstenedione => estrone, organism-specific biosystem; C19/C18-Steroid hormone biosynthesis, pregnenolone => | 
| Function | 3-beta-hydroxy-delta5-steroid dehydrogenase activity; 3-beta-hydroxy-delta5-steroid dehydrogenase activity; isomerase activity; nucleotide binding; oxidoreductase activity; | 
| ◆ Recombinant Proteins | ||
| HSD3B2-3883HF | Recombinant Full Length Human HSD3B2 Protein, GST-tagged | +Inquiry | 
| HSD3B2-4340M | Recombinant Mouse HSD3B2 Protein, His (Fc)-Avi-tagged | +Inquiry | 
| HSD3B2-29343TH | Recombinant Human HSD3B2 | +Inquiry | 
| RFL29167MF | Recombinant Full Length Mesocricetus Auratus 3 Beta-Hydroxysteroid Dehydrogenase/Delta 5-->4-Isomerase Type 2(Hsd3B2) Protein, His-Tagged | +Inquiry | 
| HSD3B2-1111H | Recombinant Human HSD3B2 Protein, His (Fc)-Avi-tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| HSD3B2-5369HCL | Recombinant Human HSD3B2 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HSD3B2 Products
Required fields are marked with *
My Review for All HSD3B2 Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            